The Crown of Thorns braided by soldiers of the governor of Judah is the Coronavirus of spike proteins gene spliced by demon possessed bio weapons military personnel
Dr Vladimir Zelenko - Successful treatment for COVID-19 and vaccine side effects with Vitamin C, Vitamin D3, Quercetin and Zinc. It's just a system for getting zinc into your cells
Prof Francis Boyle - COVID-19 is a man made Bio-weapon produced in the University of North Carolina
Dr David Martin proves from patent filings that human SARS and COVID-19 were made by Ralph Baric at the University of North Carolina, Chapel Hill - US Patent 7279327
Secular Confirmation that COVID is a man made bioweapon designed to force gene therapy vaccination
Forcing a drug upon your people can be a criminal offence for a government - a violation of the Nuremberg Code (if they have signed up to the code)
The Vaccines will cause the deadly plague of Revelation 6:8, far worse than COVD19
The spiritual power game behind the vaccines - an email sent to the LW mailing list on 2021May3
The existence of the Coronavirus of Spike Proteins, the Crown of Thorns of Matthew27, Mark15 and John19, the last abuse of Jesus before he died,
is proof that we are now in the end times
Because we are at the End of the End Times, the serpent MUST BE biting the heel of the seed of the woman today
Governments are coercing us to take COVID vaccines whilst behaving in a very satanic (controlling and love averse) way,
so it is not a great stretch of the mind to see that Satan is behind that coercion
Lockdowns and Mask Mandates are Very Bad Science
The Law of Imperial Capability
Government Psy Ops and State of Fear by Laura Dodsworth
Deception and Truth
A Good Summary of Vaccine Injuries
New Study shows that Hydroxychloroquine prescription in a much smaller dosage than Lupus, would have saved over 100,000 lives in the US. Yet it remains the only drug to ever have been banned for a specific pathogen.
Efficacy of COVID therapeutics
Fauci knew that Chloroquine was a potent SARS inhibitor in 2005
Vaccinated People should not give blood: Spike proteins are pathogenic if they get into the blood
The Cleveland Clinic Study of 52,000 medical Personnel shows that people who have recovered from COVID naturally get no benefit from vaccination and are at no further risk from COVID
Herd Immunity
COVID Vaccines are Gene Therapy
The letter of Dr Tess Lawrie to the MHRA
June 2021: Vaccines kill 2 people for every 3 that they save from COVID
Programmable Digital Currencies
Prof Montagnier says that mandatory vaccination of children is outrageous and that mid term side effects may be terminal
DNA vaccines indefinitely reprogram your cells to pour out more and more protein spikes
PHE data shows that 1 Jab is more than twice as effective as 2 Jabs
PHE data shows that doubly vaccinated over 50s and 25% more likely to catch Delta and therefore infect others than unvaccinated over 50s.
An unpublished but leaked Randomized Crossover study by Pfizer showed that vaccinated people were 300% more likely to catch Covid than unvaccinated people
Astra Zeneca is no longer effective against Delta. The rest are trailing perhaps 6 weeks behind.
The CDC Barnstable Study shows that in the US Pfizer and Moderna are no longer effective against delta
The Oxford study shows that all UK vaccines (Astra Zeneca, Moderna and Pfizer) degrade in efficacy month on month until they cease helping with viral load around 3 months after the 2nd jab
Useful home treatments for COVID (consult your doctor and do your own research - the writer is not a medically qualified doctor)
Antibody Dependent Enhancement is a worry
The number of mRNA and DNA copies in Vaccines (14.4 Trillion for Pfizer, 48 Trillion for Moderna)
62% of vaccinated people have microclots 7 days after vaccination
August1: Fauci reveals that vaccines no longer provide any reduction in severity of infection for delta
Asymptomatic Cases do not transmit the virus
The vaccine produced spike proteins are toxic when released into the blood stream and they are so released
Herd Immunity is long lasting because Natural Immunity is long lasting
PHE must be rigging their figures
All 7 Moderna Vaccine Patents were applied for over 6 months before the COVID-19 outbreak began
The WHO COVID Protocol is more lethal than the virus
Israel vs Palestine shows that Pfizer vaccines stop preventing COVID infections and deaths and then progressively increase them around 4-5 months after the 2nd shot
UK vs India case numbers show that Vaccination does not work and Ivermectin does work
Dr: Mike Yeadon: None of the COVID variants are sufficiently distinct from Wuhan Hu1 to evade natural or vaccine mediated immunity - they are psychological Scariants and Immunological Sameiants
The Resignation Letter of Nurse Emma (not sure how genuine this letter is but the argumentation is stunningly powerful - it first appeared on the site of David Icke on 2021May27)
Daily Telegraph Comment by Gordon
Israeli data show that 3rd Jabs achieve nothing at all
Reverse-transcribed SARS-CoV-2 RNA can integrate into the genome of cultured human cells and can be expressed in patient-derived tissues
The Oxford study shows that all UK vaccines (Astra Zeneca,
Moderna and Pfizer) degrade in efficacy month on month until they cease helping with viral load around 3 months after the 2nd jab
Construction site air quality meter beeps for insufficient air quality to mask wearers
Israeli study shows that natural immunity is 13x more effective than double vaccination
60% of new COVID hospital cases in Israel in 2021April occurred in vaccinated people, 80% of the people over 20 having been vaccinated.
86% of COVID cases over 20 years old in Israel in July were fully vaccinated, 84% of that population was fully vaccinated. So full vaccination made Israel's more likely to be infected in July
JP Sears on Vaccine Passports and the 10 steps to Genocide and the Tyranical Variant
All Risk No benefit: Daily Telegraph Comment September13
Oxford University Vietnam Study Shows that Astra Zeneca has Zero Effect on the Delta Variant
The Vaccines reduce the numbers of your CD8 Killer T Cells - Giving recipients a new form of AIDS - which increase cancer cases by 20x in vaccinated people
Properly Formulated Effective Medical Protocols to treat COVID19 and long Covid and vaccine side effects
The US Hospital Protocol for COVID-19 was responsible for most of the US 'COVID deaths' not the virus itself
The complete Amino Acid Sequence of SARS CoV 2 Wuhan Hu1 Genome and Vaccine Spike Protein and strong evidence that the virus was man made
New Data from the US Medicare CMS database covering 59.4 million people show that the vaccines are NOT killing large numbers of people within 14 day of a shot
CMS Medicare records for NY state show that the vaccines are NOT killing large numbers of people within 28 days of a shot.
Natural Immunity is stronger, more long lasting and more variant tolerant than vaccine immunity
The province of Uttar Pradesh in India is 6% vaccinated with a population of 241 million in the country where delta originated. It was declared Covid free in 2021September due to Ivermectin, not vaccines
Humetrix AI DOD study of 5.6m Medicare recipients over 65 shows that breakthrough infection rates 5-6 months after vaccination are 2x the 3-4 month figure. 71% of cases in August were in vaccinated people who comprised 80% of the group
Dr Nathan Thompson does an immune system test (AIDS progression test basically) before and after first and 2nd shot and finds that the vaccines destroy the immune system
Raw Covid Mortality and All Cause Mortality Data from the UK Office of National Statistics show that doubly vaccinated people were 6x more likely to die of all causes than unvaccinated people from the end of April to the beginning of July this year. This is the first government data to trap the scale of the lethal side effects of the Covid shots
What happens when the Pfizer Vaccine is added to blood under the microscope?
The Big Picture: Worldwide analysis of 188 nations shows a massive correlation between vaccination and higher case rates. It is the vaccinated leading the unvaccinated
COVID19 Counts as 616 the number of the beast
Funeral Director sees Unprecedented Levels of Dead Babies Piling up in Mortuaries and Totally Suppressed Vaxxed Covid Death Rates
The Septicemia death rate in the 21,926 doubly vaccinated group of the Pfizer Phase III Clinical trial was 21x normal. The Cardiovascular death rate was 2x normal
CDC admits that they have no record of a person with natural immunity becoming reinfected and transmitting Covid-19 to any other person
Pfizer Successfully Treat Covid with the HIV Drug Ritonavir
ARE YOU A VAXXIST?
The Former chairman of the Royal college of Physicians and Surgeons in Canada Nails it!
A biblical explanation of why the world will end at the 7th Jab and who is really behind the vaccine mandates
Age Readjusted Scottish Death Rate figures from PHS combine with Age Stratified English Infection Rate figures from UKHSA in a Great Union which shows that doubly vaccinated over 30s are 286% more likely to die of Covid than unvaccinated over 30s
American Heart Association Presentation shows that mRNA vaccines more than double the 5 year chances of getting a heart attack
The Expose Stands By Novak Djokovic: Will you join us?
Vaccines Projected to Cause 62.3 Milliom Cardiovascular Deaths in 2022 Worldwide. Football Heart Attack Deaths in December 2021 Alone Matched the Annual Average for the last 12 Years. Worldwide Football Pitch Cardiovascular Deaths in 2021 were 15 times higher than in 2020.
Footballer Cardiovascular Deaths are rising exponentially - They are doubling every 3 months
Masks,
Travel Restrictions and Isolating People who are not sick were known to be ineffective in fighting a flu pandemic in 2006
Toxicologist and Molecular Biologist Janci Chunn Lindsay Makes the Case for a Genetic Vaccination Ban
The Vaccines are prolonging the pandemic and preventing us reaching herd immunity
Casey Hodgkinson - The Most Eloquent Condemnation of mRNA (Pfizer) Vaccines We have Ever Seen
Every Vaccination is a vote in a Global Election. It is a vote for the new Global Dictatorship
Latest ONS and UKHSA figures show that Triply vaccinated 40-49 year olds are 10.3x more likely to catch Omicron than their unvaxxed counterparts
Sucharit Bhakdi, MD and Arne Burkhardt, MD find by autopsy that 14 out of 15 people who died with no mention of the vaccine, died of the vaccine
German Government Data for Omicron confirms that most of the "fully vaxxed" will have full blown Vaccine AIDS by the end of January. They are presently down to the last 12.3% of their immune response
OneAmerica Life Insurance Data show that vaccinated people between 18-64 years old are 50% more likely to die than unvaccinated people
Brilliant Goodbye letter from Unvaxxed Suspended Royal Canadian Mounted Police Corporal Richard Mehner
The latest UKHSA Vaccine Surveillance Report figures show that boosters massively accelerate immune system degradation and that most fully vaxxed people will have full blown VAIDS by the end of February
Vaccines are not Waning. Vaxxed immune systems are waning
Letter of Professor Ehud Qimron, head of the Department of Microbiology and Immunology at Tel Aviv University,
to the Israeli Ministry of Health
Latest UKHSA Figures Show That Vaccination Doubles Your Chances of Catching Covid
Government figures show that Fully vaxxed Australians in New South Wales are 2.2x more infectious than unvaxxed Aussies
Fully Vaxxed Australians in NSW are over 10X more likely to be infected with Omicron than unvaxxed Aussies according to the latest government figures
Covid19 vaccines achieve full poison status: Double vaxxed now have increased case, hospital and death rates
The 19 Deceptions of Covid19 mRNA Vaccination
The Billion Life Covid19 Fraud
The Expose Guide to Vaccination Genetics: How the vaccinated become GMO humans
PfizerGate: The Worldwide Cover Up of Vaccine Damage
Dr Chetty has discovered that most Covid19 mortality is due to an allergic reaction to the spike protein
Corona is the Latin word from Crown. Coronavirus is 100 nanometers in diameter and in section looks like a crown covered in spikes. It is a sphere covered in spikes which connect to cellular ACE2 receptors and insert the virus RNA into our cells.
LIDDELL: SPE /IRA,
h`,
Lat. spira,
anything wound or coiled:
in pl. the coils or spires of a serpent
STRONG: S4757
stratiwthj
stratiōtēs,
strat-ee-o´-tace; from a presumed derivation
of the same as 4756 stratia;
a camper-out, i.e. a (common) warrior
(lit. or fig.):—soldier:
There are 3 parallel account of Soldiers Braiding/plaiting/double helixing a crown/corona of thorns/spike proteins and putting it on Jesus' head. By the parallel account principle of the bible code there must therefore be 3 independent fulfilments which combine to make a whole picture, 3 slices of a cake, which together make a whole cake. All 3 accounts share the same symbolism.
Reappointed Laodicea
27 Then the soldiers [stratiwthj]
of the governor [Demon possessed members of the US military, since the 1NC churches, the Watchtower and Laodicea, the 7th church of Revelation3, have their Head Quarters in the US] took Jesus into the governor's palace and gathered the whole body/coil [speira]
together to him [all of the 1NCs finished being gather to him by 3EC baptism in reappointed Laodicea] .
28 And disrobing him [destroyed his priesthood], they draped him with a scarlet cloak [xlamuj]
[General's/Military cloak: Hiding his body -
lockdown hiding?],
29 and they braided/plaited/double helixed [US military personnel gene spliced the COVID19 RNA from synthetic DNA, which is twisted, braided, plaited RNA in a double Helix, a molecular plait.
Plaits/Braids are helical!]
a crown out of thorns [2x. corona is a Latin feminine noun meaning crown. So a corona of spike proteins] and put it on his head [Jesus head is the 1NC saints of the 3rd Holy Spirit. 1NC reserves on earth, are protected from COVID by Psalm91 and Genesis15. But they are not protected from the vaccines]
and a reed in his right [hand] [a satanic reed, demon possessed people became the rulers of Laodicea and non adamic Sodom]. And, kneeling before him [They kneel before the Laodicean or non adamic Sodomite priest who represents Jesus],
they made fun of him, saying: Good day, you King of the Jews! [Literally he was not. In the end times fulfilment he is the secular King of the Jews. He is Caesar when this is set]
30 And they spit upon him [that is how Coronavirus (COVID19) is transferred. Demon possessed soldiers released it into the world targeting Jesus, the 1NCs] and took the reed and began hitting him upon his head [forcing the coronavirus spike proteins into his head, the 1NC reserves - through the vaccine - using the demon possessed reed of the administration of non adamic Sodom. So there are demon possessed fake 1NCs in non adamic Sodom along with sealed married true 1NCs who have not yet been inducted into the 3rd Holy Spirit, but are still on the substitute bench. There is a Judas class that is known to Jesus but not removed from the congregation].
31 Finally, when they had made fun of him, they took the cloak off and put his outer garments upon him and led him off for impaling/crucifixion [staurow].
(Matthew 27 NWT)
14 And Adam was not deceived, but [the] woman being deceived is caused to be in transgression; (1 Timothy 2 GLT - adapted)
So the substitute 1NC reserves of the woman, the 3rd Holy Spirit ARE in transgression due to being deceived by the serpent. WOW!
The soldiers both braid/plait the crown of thorns and put the reed in his hand.
So these soldiers are demon possessed people in the jurisdiction of the governor covering the church housing the 1NCs, which church is the reappointed Laodicea and non adamic Sodom. The Greek word for solider stratiwthj
is literally an outside camper or expeditioner. So it means descended demons who are on an expedition to earth AND it means solders in the military.
non adamic Sodom
16 The soldiers [not of the Governor, Satan1, who has by now repented] now led him off into the courtyard,
that is, into the governor's palace; and they called the whole body of troops together [All the 1NCs were called together in non adamic Sodom for the 6th and 7th marriage Passovers],
17 and they decked him with purple and braided/plaited/double helixed a thorny crown and put it on him.
18 And they started greeting him: Good day, you King of the Jews!
19 Also, they would hit him on the head with a reed [forcing the coronavirus spike proteins into his head, the 1NC reserves - through the vaccine - using their secular authority - their reed - to compel people to get the vaccine which gives the Mark] and spit upon him [this means that soldiers released COVID19 Mark2 upon mankind. so spitting is how it is transferred] and, bending their knees, they would do obeisance to him.
20 Finally, when they had made fun of him, they stripped him of the purple and put his outer garments upon him. And they led him out to impale him. (Mark 15 NWT)
2NC Zoar
1 At that time, therefore, Pilate took Jesus and scourged him.
2 And the soldiers braided/plaited/double helixed a crown out of thorns [2x.
a virus resulting from the spike proteins produced by the vaccine] and put it on his head and arrayed him with a purple outer garment;
3 and they began coming up to him and saying: Good day,
you King of the Jews! Also, they would give him slaps in the face [which confirm the absence of a reed].
4 And Pilate went outside again and said to them: See! I bring him outside to you in order for you to know I find no fault in him.
5 Accordingly Jesus came outside [of the governor's place, the Watchtower], wearing the thorny crown
and the purple outer garment. And he said to them: Look! The man! [no outer garments given back purple outer garments left upon him] (John 19 NWT)
plekw To plait, twine or braid - Double Helix and Gene Splicing. The head of Jesus is the 1NCs. They have been exposed to COVID but been protected by God due to Psalm 91 and Genesis 15. But they have taken the vaccine !!
The Governor is Satan1
The Governor's Palace is reappointed Laodicea which was run by Satan1 who possessed the President of Laodicea and presided over the Watchtowers Passovers - see U853.
Soldiers are descended demons
Crown out of thorns of Matthew is COVID19 braided by soldiers and infected by spitting of Matthew 27:30
Thorny crown in both Mark and John is COVID19 Variants for thorny crown is a variant way to say crown of thorns, braided by the soldiers and infected by the spitting of Mark 15:19
Crown of thorns of John is COVID21, which is the deadly plague of Revelation 6:8, braided by the soldiers but NOT infected by spitting. It is a virus made out of the spikes of a vaccine. The infection results from a vaccine injection - which has a time delayed deadly plague built into it ADE? It does not result from spitting.
So one or some or all of the vaccines is/are a lethal Trojan containing COVID21.
The Astra Zeneca vaccine codes for spikes which are a direct copy of Wuhan COVID19. The Pfizer. Moderna. Novavax and J&J vaccines code for a stabilised spike. This stabilised spike has the potential to be or to produce COVID21. So the Astra Zeneca vaccine, since it codes for the regular spike of COVID19, cannot produce COVID21. But the Pfizer, Moderna, Novavax and J&J vaccines may well code for COVID21, the deadly plague of Revelation 6:8. However if the delta or lambda or beta variant is the deadly plague then Astra Zeneca presently looks like the most dangerous vaccine for that variant (as of July21) - https://thetruthiswhere.wordpress.com/2021/07/18/might-covid-injections-reduce-lifespan/
A snake has two fangs and they are recommending 2 shots of the vaccines. Snake venom often kills. That is the symbolism of Genesis 3:15. We strongly suspect that the stabilised spike vaccines are the Trojans not Astra Zeneca vaccine..
1. COVID19 was made by the US military and they must have made a vaccine too,
since it is a bio weapon. Pfizer and Moderna and J&J and Novavax are US company created vaccines.
2. All Israel has had Pfizer and the demons always persecute the Jews.
3. Astra Zenceza has had terrible press about blood clots and is banned or suspended regularly. Whereas Pfizer produces just as many blood clots and yet has never been banned.
This means that although the 1NC reserves have now all married Jesus, they have not been taught by him how to interpret the bible for he is presently wearing a crown of thorns n his head. His head is infected with COVID19 - from the vaccine. This has huge spiritual significance. The Holy Spirit wrote the bible. But the prophet, the dreamer cannot be the interpreter of his speech, his dream. So the Holy Spirit does not interpret its inspired words, a bible interpreter must do that. So the LWs shall indeed teach the 1NC reserves for 50 days of Mark6 face to face.
A plaited crown of thorns is a gene spliced RNA/DNA Coronavirus of protein spikes.
https://commons.wikimedia.org/wiki/File:Difference_DNA_RNA-EN.svg
43 Because the days will come upon you when your enemies will build around you a fortification with pointed stakes and will encircle you and distress you from every side, (Luke 19 NWT)
43 For the days will come on you, and [ones] hostile [to]
you will raise up a rampart to you and will surround you and will keep you in on all sides, (Luke 19 GLT)
43 Because will arrive days upon you and will throw in beside the enemies of you palisade [carax]
to you and they will encircle you and they will distress you from every side,
(Luke 19 KIT)
43 oti hxousin hmerai epi se kai peribalousin oi ecqroi sou caraka soi kai perikuklwsousin se kai sunexousin se pantoqen (Luke 19 VatB)
LIDDELL: ca,rax, a±koj( o`, also h`, (ca±ra,ssw) a pointed stake:
Jerusalem, the head of Judea, was given a crown of thorns, an encircling palisade of pointed stakes, just before it was destroyed by the Roman General Titus in 70 CE. That was the end of the temple and of the Jewish system of things.
So we should expect the same thing to occur at the end of the world! Not only to physical Jerusalem (the archetypical woman below), but to spiritual Jerusalem, to heavenly Jerusalem (the woman above).
Vitamin C, Vitamin D3 Zinc and Quercetin are all commonly available supplements. So Dr Zelenko recommends the above quantities once per day as a prophylactic (before catching COVID-19). If you catch COVID, then perhaps double the dosage.
This daily regime (according to Dr Zelenko) will also help avoiding the cytokine storm caused when a person vaccinated over 5 months ago is challenged with any virus attack. So it should be a good insurance policy against the vaccines.
The Biological Weapons Anti-Terrorism Act of 1989 (BWATA) was drafted by University of Illinois international law professor Francis Boyle. The law, known as it went through the U.S. Senate during the 101st U.S. Congress as S. 993, was introduced to the Senate on May 16,
1989. The bill was sponsored by U.S. Senator Herb Kohl (D-WI) and collected 15 co-sponsors on its way through the Senate.] An amended version of the bill passed the Senate in November 1989.
The U.S. House of Representatives version of the bill, carrying the same title, was introduced to the House on January 3,
1989. The sponsor of BWATA in the House was Representative Robert W. Kastenmeier (D-WI) and the legislation picked up 52 co-sponsors as it went through the House. The House of Representatives passed BWATA on May 8, 1990. BWATA was signed into law by then-U.S. President George H.W. Bush on May 22,
1990.
His view is that
1. All BSL3 (Bio Safety Level 3) and BSL4 labs are used to make Bio Weapons.
Nothing else can explain their huge budgets which are larger than that of the Manhattan project.
2. The WHO and the CDC know all of this and are in on the deception. They know the COVID is a man made bio weapon.
3. There has been a vaccine in existence from the start of the pandemic but its existence has been hidden, because its early existence would prove that COVID 19 was a man made bio weapon. Bio weapons have an offensive and a defensive component
4. North Carolina University gave COVID to the only BSL4 lab in China in Wuhan. There is some kind of relationship between the University of North Carolina and Fort Detrick, the only Bio weapons facility in the US.
5. The Aussies genetically engineered COVID-19 from scratch and supplied it to Wuhan.
6. North Carolina added gain of function to SARS and added some components of HIV to make COVID - 19.
https://www.youtube.com/watch?app=desktop&v=3DAI3c9wE0Q
https://rumble.com/vd6jjp-david-martin-full-interview-planet-lockdown.html
https://odysee.com/@Corona-Ausschuss:3/Sitzung-60-Die-Zeit-ist-kein-flacher-Kreis-5-Martin
Homepage COVID info
Fascinating videos. He proves that COVID is certainly man made by the US. And that although the virus is real, the infection rate and death figures are controlled by the Gates Foundation, Facebook Funders and Fauci, and are all hyped for the purpose of forcing people to take a gene therapy. His SECULAR position, is that the whole pandemic was created and over hyped in order to force a gene therapy which does not impart immunity to the virus (actually it does temporarily, but then it destroys your immune system which defeats the temporary advantage).
This ties in perfectly with our spiritual argument which is that this is all a fulfilment of the Genesis 3:15, where the Serpent is trying to get more seed by gene therapy - by injecting us with snake venom using deception - snakes move sideways and have forked tongues. The next stage biblically is WW3 (the 2nd horseman of the apocalypse). Then we shall have rationing causing Famine (the 3rd horseman of the apocalypse). And you will not get your rations unless you take the mark of the beast, which is an mRNA vaccine Passport. Fantastic info thanks so much. mRNA vaccines lead to the deadly plague of the 4th horseman of the apocalypse of Revelation6:8. Stock up on food or better still on faith and love.
Here is what the demons should be saying: Hi were demon possessed people and we are trying to get everyone to have the genetic signature of our master who is Cain. You know him, the first one of Satan's seed, the guy who killed Abel. Cain means spear, needle, spike in Hebrew. Eve called him that because Satan pierced her in order to make Cain. But the demons thought that wouldn't sell too well. So they came up with COVID and hyped it beyond belief.
https://www.newsmax.com/politics/hhs-wuhan-lab-oversight-board/2021/04/05/id/1016402/
Fauci and Moderna sent COVID vaccine candidates for efficacy testing 1 month before COVID was publicly identified - https://banned.video/watch?id=60d3b4d14f679e23616717fa
https://www.organicconsumers.org/blog/covid-19-spike-and-furin-cleavage
Dr Richard Fleming shows that Ralph Baric developed Covd19 and that it may cause a condition similar to BSE - https://www.bitchute.com/video/MqGw27daj37K/
The scriptural interpretation of soldiers of the governor (Caesar's representative as Pilate was) of God's people in whom Jesus resides is the military forces of Caesar to the reappointed Laodicea (who held the 1NC reserve marriage Passovers) and non adamic Sodom (which was the 1NC and HLC fragment of Laodicea). The governor is the US government, Caesar is the Dragon and deep state wild beast of Revelation13 which got the 42 months of Authority from 2019Nisan22 to 2022Tishri14. So the US military bio weapons people created COVID19. They braided/plaited the crown of thorns, they gene spliced the double Helix (plaited) DNA and RNA of the coronavirus (crown-virus) of spike proteins.
This interpretation appears to be confirmed by Prof Boyle. The US military created it in Fort Detrick in Maryland (the centre of all US bio weapons production). Then in August 2019 the bio weapons part of Fort Detrick closed down due to a leak of dangerous materials. This was 3 months before COVID19 was first recognised overtly in Wuhan.
On August 7th, 2019, its deadly germ research operations were abruptly shutdown following serious safety violations, in particular relating to the disposal of dangerous materials - https://en.wikipedia.org/wiki/Fort_Detrick
The CDC issued a Cease and Desist to Fort Detrick on 2019July15. The lab put all research on hold on August2 and was shut down on 2019August7 according to Fredericknewspost.com reported by Heather Mongilio - https://madisonarealymesupportgroup.com/2019/08/07/fort-detrick-lab-shut-down-after-failed-safety-inspection-all-research-halted-indefinitely/
https://www.military.com/daily-news/2019/11/24/cdc-inspection-findings-reveal-more-about-fort-detrick-research-suspension.html
The lab reopened partially in late November 2019 and fully reopened in April 2020. The Link has now been changed, the article has been suppressed.
https://www.fredericknewspost.com/news/health/fort-detrick-lab-shut-down-after-failed-safety-inspection-all-research-halted-indefinitely/article_767f3459-59c2-510f-9067-bb215db4396d.html
Link does not work for EU people any more. It worked when it was first posted!
The Wuhan lab got a $3.7 million grant from the US government approved by Obama running over 4 years from 2015 to 2019. - https://www.snopes.com/fact-check/obama-admin-wuhan-lab-grant/
"The controversy was such that it led to a Congressional moratorium on chimeric research in the USA. At which point, Dr. Antonio Fauci diverted 3.7 Million U.S. Dollars of U.S. Taxpayer monies to the Wuhan Institute of Virology to continue the research.
Rudy Giuliani, legal counsel to U. S. President Donald Trump, and former Mayor of New York city, recently demanded an explanation from Dr. Fauci for this transfer, which violated U.S. Laws against funding the research.
In addition to the research done at Chapel Hill, North Carolina, the specific kind of research into Coronaviruses as possible biological warfare agents, was being done at Fort Detrick, Maryland, USA, by the U. S. Army, which has a Level 3 and 4 Biowarfare Lab at the military base. This lab was cited by the U.S. Center for Disease Control and Prevention (CDC) in July, 2019 for failure to maintain proper containment standards"
- https://www.fromrome.info/tag/fort-detrick/
Fauci also gave them $3.7 million from the NIAID (National Institute of Allergy and Infectious Diseases) - In 2019, with the backing of NIAID, the National Institutes of Health committed $3.7 million over six years for research that included some gain-of-function work. The program followed another $3.7 million, 5-year project for collecting and studying bat coronaviruses, which ended in 2019, bringing the total to $7.4 million. - https://www.newsweek.com/dr-fauci-backed-controversial-wuhan-lab-millions-us-dollars-risky-coronavirus-research-1500741
Fauci's NIAID Co-Worker Secretly Mocked, Criticized Him Using the Pseudonym Streiff on a Conservative Website: "I think we're at the point where it is safe to say that the entire Wuhan virus scare was nothing more or less than a massive fraud perpetrated upon the American people by 'experts' who were determined to fundamentally change the way the country lives and is organized and governed," Streiff wrote in June." - https://www.newsweek.com/faucis-niaid-co-worker-secretly-mocked-criticized-him-using-pseudonym-conservative-website-1533361
Main Stream media as of late May accept that COVID resulted from gain of function research and leaked from the Wuhan lab - https://video.foxnews.com/v/6256037886001/
Prof Luc Montagnier who won the Nobel Prize for discovering HIV knows that it is man made - https://www.lifesitenews.com/news/nobel-prize-winner-mass-covid-vaccination-an-unacceptable-mistake-that-is-creating-the-variants
The phenomenon of Herd immunity exists because natural immunity and non gene therapy vaccination immunity (polio,
BCG, MMR etc) are long lasting. The immune system does not forget the lessons it has learned. Gene therapy immunity is quite strong at first but vanishes entirely around 4-5 months after the 2nd Jab as the latest PHE Technical Briefing 17-23 figures and Vaccine Surveillance Report Weeks36-40
and the CDC Barnstable study show. This is not because the vaccines lose efficacy. Their job is to train the immune system and they succeed in doing that as the short term results show. The loss of immunity is because they also progressively month on month damage the immune system and that damage overtakes the benefit of the initial immunization 4-5 months after the 2nd Jab. It is not because the immune system forgets what is was told 5 months earlier. It is because the vaccines eventually do more harm than good to the immune system. That is why the globalists are pushing them so hard. They need to get everybody vaccinated before it becomes too obvious that the vaccines are a short term immunity booster combined with a medium term immunity compromiser.
COVID is a man made bioweapon, made more infectious by the man made polybasic (PRRAR) furin cleavage site placed in the perfect position in the spike protein chain to infect humans - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7194065/. It carries its pathogenicity in its spikes. The vaccines code for those very spikes.
These spikes slowly degrade your immune system to the point where the benefit of the initial COVID spike training is overtaken. From then onwards they make you more likely to be infected with COVID-19 and less able to fight it when infected. They effectively give you a form of AIDS, which is hardly surprising since their infectivity comes from the furin cleavage site which is identical to that found in HIV1 and was most probably gene spliced from that HIV1 into the Coronavirus in Wuhan or Chapel Hill. Both COVID-19 and the vaccines contain genetic material from HIV1 and HIV2, the charming concoctions that they are.
Modernas own website at https://www.modernatx.com/patents
shows the following 7 patent filings for their gene therapy mRNA-1273 (amino acid chain) vaccine...
US 10,703,789 filed January 12 2019
US 10,702,600 filed February 28 2020
US 10,577,403 filed June 12 2019
US 10,442,756 filed December 18 2017
US 10,266,485 filed June 11 2018
US 10,064,959 filed April 21 2017
US 9,868,692 filed July 27, 2017
The 2nd patent, filed on February 28 2020 was a continuation of an earlier patent application number 16/368,270 which was filed on March 28, 2019
So they had all 7 patents applied for by June12, 2019, which is quite impressive given that the WHO was only informed of a pneumonia type outbreak in Wuhan on December 31, 2019.
So all the patents needed to protect Moderna's particular vaccine monopoly were applied for more than 6 months before the outbreak of the disease that the vaccine is supposed to be curing.
This proves that the purpose of the 'lab leak' was to make a market for pre-existing vaccines in the case of Moderna. The leak occurred to force people to have to take the vaccine.
1999: U.S. Dept. of Health & Human Services (HHS) funds research amplifying the infectious character of Coronaviruses.
2000: In May Ralph Baric successfully applies reverse genetics (composite DNA)
to a rescued infectious clone of SARS-CoV Urbani.
2001: April 20: NIH Grant GM63228 funds Ralph Baric et al at the University of North Carolina at Chapel Hill to do Chimera research to transform the original SARS Coronavirus which was pathogenic only to animals, existing in nature as a pathogen for dogs and rabbits, to make it pathogenic to mankind targeting lung epithelial cells. The justification for this research was that it was supposedly designed as a vector virus to distribute HIV vaccines. This resulted in US patent application US28531801P
2002: April 19: The University of North Carolina files US patent 7279327 for an infectious replication defective coronavirus (to be used as a virus vector for an HIV vaccine), claiming priority from US28531801P. Inventors were: Kristopher M. Curtis, Boyd Yount, Ralph S. Baric
2002: November16: SARS outbreak in Guangdong province of China bordering on Hong Kong. What a coincidence!
2003 April 25, 2003 CDC Patent filed and ultimately becomes US 7,220,852 (the patent on the RNA sequence) and 7,776,521 (the patent on the testing methodology. These patents give the U.S. Department of Health and Human Services the ability to control the commercial exploitation of SARS coronavirus.
2003: Dr. Ralph Baric at UNC Chapel Hill receives NIH grant AI23946-08 officially classified as affiliated with NIAID (run by Anthony Fauci). Baric works on synthetically altering Coronaviruses.
2003: Dr. Anthony Fauci appointed to the Bill and Melinda Gates Foundation’s Global Grand Challenges Scientific Advisory Board (served through 2010 - when he joined their Global Vaccine Action Plan).
2010: August 6: Moderna (prior to its establishment) files U.S. Patent 9,447,164 which attracted the investment of (and “inventorship” for) venture capitalists at Flagship Ventures. This patent grew out of the work of Dr. Jason P. Schrum of Harvard Medical School supported by National Science Foundation Grant #0434507. While the application claims priority to August 2010, the application didn’t get finalized until October, 2015.
2010: Moderna (MODEfied RNA) was incorporated in 2010.
2010: The World Health Organization (WHO), UNICEF, the National Institute of Allergy and Infectious Diseases (NIAID) and the Bill & Melinda Gates Foundation have announced a collaboration to increase coordination across the international vaccine community and create a Global Vaccine Action Plan.
https://www.gatesfoundation.org/ideas/media-center/press-releases/2010/12/global-health-leaders-launch-decade-of-vaccines-collaboration.
The Leadership Council is comprised of:
Dr. Margaret Chan, Director General of WHO;
Dr. Anthony S. Fauci, Director of NIAID, part of the National Institutes of Health;
Mr. Anthony Lake, Executive Director for UNICEF;
Ms. Joy Phumaphi, Chair of the International Advisory Committee and Executive Secretary, African Leaders Malaria Alliance
Dr. Tachi Yamada, President of Global Health at the Bill & Melinda Gates Foundation
2012 September 22: UK Identifies first case of MERS
2015 July: South Korea had its last case of MERS. There were 2,494 confirmed laboratory cases and a total of 858 deaths in 27 countries; 80% of these cases came from Saudi Arabia. So the mortality rate for MERS was 34.4%. But it was not very transmissible. Infections were limited to family members, other hospital patients and health care workers who encountered MERS patients.
2018: US Patent 7279327 for the chimeric adaption of the naturally occurring animal SARS Coronavirus to become infectious to humans targeting lung epithelial cells is transferred from University of North Carolina to he US National Institute for Health (NIH) - who funded it in the first place.
2018 March 27: Peter Daszac and the Eco Health Alliance in 2018 submitted a proposal to DARPA to do gain of function research on SARS coronaviruses to insert is furin cleavage site (such as is found in HIV1) in an optimal position into the coronavirus gene. COVID-19 has a furin cleavage site optimally positioned to infect humans. https://theintercept.com/2021/09/23/coronavirus-research-grant-darpa/
Let’s look at the big picture: A novel SARS coronavirus emerges in Wuhan with a novel cleavage site in it. We now have evidence that, in early 2018, they had pitched inserting novel cleavage sites into novel SARS-related viruses in their lab,” said Chan. “This definitely tips the scales for me. And I think it should do that for many other scientists too.”
https://www.documentcloud.org/documents/21066966-defuse-proposal - this is the Eco health alliance DARPA funding proposal.
Oh dear. That really nails it. DARPA confirms that Peter Daszac of the Eco Health Alliance submitted a proposal on 2018March27 to add an HIV1 type furin cleavage site to SARS1 and SARS CoV 2 has that furin cleavage site. Fauci funded Wuhan through the Eco Health Alliance.
2019: November: University of North Carolina, Moderna and NIH began the sequencing of the 1273 amino acid spike protein vaccine a month before the outbreak actually occurred.
2019: December31: WHO is informed of a pneumonia type outbreak in Wuhan.
https://odysee.com/@Corona-Ausschuss:3/Sitzung-60-Die-Zeit-ist-kein-flacher-Kreis-5-Martin
https://www.davidmartin.world/wp-content/uploads/2021/01/The_Fauci_COVID-19_Dossier.pdf
https://www.algora.com/Algora_blog/2021/06/27/dr-peter-mccullough-whistleblowers-inside-cdc-claim-injections-have-already-killed-50000-americans
So COVID-19 is not a naturally occurring virus, it is man made. It was not made in Wuhan.. It was originally made in Chapel Hill and funded by the NIH. It is actually the NIH Virus. In fact all SARS viruses which infect humans are based on the original SARS-NIH virus from the University of North Carolina.
Furthermore it is not COVID-19. The virus was made to be pathogenic to humans in 2002 and was adapted by computer modelling until 2010 when Moderna was set up to profit from mRNA vaccines to supposedly defeat it. And further adapted thereafter.
COVID-19 counts as 100+0+6+500 (latin) + 1+9 = 616 of Revelation13.
So we suspect that COVID-19 is in fact COVID-10. Because what is called COVID-19 (due to the first identification via an outbreak occurring in 2019) may have been completed in 2010 when Moderna was incorporated and when the WHO-UNICEF-Fauci-Gates Global Vaccine Action Plan was hatched.
THE INTERNATIONAL CRIMINAL COURT ACCEPTED THE COMPLAINT FOR VIOLATION OF THE NUREMBERG CODE OF THE ISRAELI GOVERNMENT - https://www.databaseitalia.it/il-tribunale-penale-internazionale-ha-accolto-la-denuncia-per-violazione-del-codice-di-norimberga-del-governo-israeliano/ - use google translate
Judge for yourself whether or not your government, your employer or your sports venue or social venue is violating it - https://www.ushmm.org/information/exhibitions/online-exhibitions/special-focus/doctors-trial/nuremberg-code
1. The voluntary consent of the human subject is absolutely essential.
This means that the person involved should have legal capacity to give consent; should be so situated as to be able to exercise free power of choice, without the intervention of any element of force, fraud, deceit, duress, over-reaching, or other ulterior form of constraint or coercion; and should have sufficient knowledge and comprehension of the elements of the subject matter involved as to enable him to make an understanding and enlightened decision. This latter element requires that before the acceptance of an affirmative decision by the experimental subject there should be made known to him the nature, duration, and purpose of the experiment; the method and means by which it is to be conducted; all inconveniences and hazards reasonably to be expected; and the effects upon his health or person which may possibly come from his participation in the experiment.
The duty and responsibility for ascertaining the quality of the consent rests upon each individual who initiates, directs or engages in the experiment. It is a personal duty and responsibility which may not be delegated to another with impunity.
2. The experiment should be such as to yield fruitful results for the good of society, unprocurable by other methods or means of study, and not random and unnecessary in nature.
3. The experiment should be so designed and based on the results of animal experimentation and a knowledge of the natural history of the disease or other problem under study that the anticipated results will justify the performance of the experiment.
4. The experiment should be so conducted as to avoid all unnecessary physical and mental suffering and injury.
5. No experiment should be conducted where there is an a priori reason to believe that death or disabling injury will occur; except, perhaps, in those experiments where the experimental physicians also serve as subjects.
6. The degree of risk to be taken should never exceed that determined by the humanitarian importance of the problem to be solved by the experiment.
7. Proper preparations should be made and adequate facilities provided to protect the experimental subject against even remote possibilities of injury, disability, or death.
8. The experiment should be conducted only by scientifically qualified persons. The highest degree of skill and care should be required through all stages of the experiment of those who conduct or engage in the experiment.
9. During the course of the experiment the human subject should be at liberty to bring the experiment to an end if he has reached the physical or mental state where continuation of the experiment seems to him to be impossible.
10. During the course of the experiment the scientist in charge must be prepared to terminate the experiment at any stage, if he has probably cause to believe, in the exercise of the good faith, superior skill and careful judgment required of him that a continuation of the experiment is likely to result in injury, disability, or death to the experimental subject.
Astra Zeneca causes 3x less deaths than Pfizer
https://www.investmentwatchblog.com/pfizer-vaccine-has-three-times-more-deaths-than-astrazeneca/
Also Astra Zeneca is obviously better at protecting people because the UK figures are by far the best in the world and we take more Astra Zeneca than anyone else. AZ has been quite an astonishing success over here.
So from a physical perspective AZ is a 3x safer bet and provides better COVID protection. But if you
take it then please take LOADS of triple strength Omega3 fish oil to protect against blood clots and strokes. But better not to take any vaccine.
Because they all contain the spikes of Cain, which begin the process of making you genetically into the seed of Cain.
We have now seen clearly from the scriptures that ONE of the types of vaccine is a Trojan. It cures COVID19 (from 2019) but will cause COVID21 (from 2021), which is the deadly plague of Revelation6, the 4th horseman of the apocalypse - far more lethal than COVID19
This type we think is the stabilised spike type of Pfizer, Moderna, Novavax and J&J. These may have a time delayed new virus (COVID21) within them, that will kill people in a few months time (counting from April 2021).
However all the vaccines are spiritually lethal since the demons made the Wuhan virus, and vaccines replicate the spike/spear/Cain from that virus. And the spiritual merges with the physical in early 2022. So please delay taking any vaccine until more is known. If you have to take one, then take the Astra Zeneca one because...
1. Several governments have banned AZ and the US FDA has not authorised it even for emergency use. So they are pushing people away from AZ and towards Pfizer.
2. Demons like to kill Jews, and all Israel took Pfizer, none of them took AZ.
3. Foxnews now covers the story that COVID19 was man made...
https://www.bizpacreview.com/2021/01/25/steve-hilton-finds-stunning-covid-19-evidence-specific-activity-that-dr-fauci-funded-and-it-is-terrifying-1020943/
https://www.foxnews.com/media/did-u-s-taxpayers-fund-research-that-became-the-coronavirus-lawrence-jones-and-steve-hilton-react.
It is a bio weapon. It is weaponized flu. So they would have made the antidote at the same time as the virus (according ot Prof Francis Boyle who wrote the bio weapons treaty). And Pfizer was the first vaccine (its release was delayed because drugs companies do not like Trump) But still it was the first.
4. COVID19 was made by the US military in Fort Detrick, which closed down its bioweapons division in September 2019, 3 months before Wuhan, due to a leak. So the US vaccines will have the Trojan. So it is Pfizer, Moderna, Novavax and J&J vaccines which must be avoided.
5. Alex Jones and infowars have been on top of this from the start - https://www.infowars.com/posts/smoking-gun-video-fauci-project-manager-confesses-to-creating-covid-19/
The bible clearly (in coded form) declares that demon possessed military bio weapons or demon possessed drugs company people made...
1..COVID19 (2019)
2. ONE of the variants (not all of them)
3. Corrupted one or more of the vaccines, the ones which contains COVID21 (2021)
God requires 3 witnesses to condemn a person to death. So one may need a 3rd jab in order to receive the Mark of the beast (which is not a vaccination but a vaccination Passport or the social credit score associated with a vaccine passport).
Dear Brothers and Sisters,
The 1957 and 1968 Asian flu pandemic experiences wherein economies were not destroyed and herd immunity was reached after a few months and the government intervention was limited to recommending fruit, show that the better course for the COVID19 pandemic would have been Vitamin C Vitamin D and exercise.
If destructive lockdowns and the loveless face masks had been deployed for medical reasons they would by now have been lifted in the UK where the pandemic is over. But they have not been lifted. So now we can see they were never about health.
[[Indeed 60% of COVID cases in Israel are now in vaccinated people in circumstances where 80% of the population is vaccinated exclusively with Pfizer. This means that Pfizer offers 62.5% real world protection , not 95% as they claimed. Whereas boosted Vitamin D offers 60% reduction in COVID mortality and 80% reduction in intensive care visits. So there is nothing between them - see truebiblecode.com/mRNA.html for the calculations and links to the soruce studies.]]
That means neither are the vaccines about health. They are about genetic control. We are in a dystopian sci-fi novel written 1950 years ago by the apostle John. The lockdown is to coerce the vaccine. Vaccine passports will become the Mark of the Beast. You will not be able to buy or sell without them later this year. That is easy to see physically, politically now. Scripturally the Mark of the Beast is first compelled on 6-16 day which is 2021Elul16, Elul being the 6th month of the Biblical Hebrew Calendar. It is 2021August26/27 Gregorian.
16 And the small and the great, and the rich and the poor, and the freemen and the slaves, it causes that they give to them all a mark on their right hand, or on their foreheads/space between the eyes,
17 even that not any could buy or sell, except the [one]
having the mark, or the name of the beast, or the number of its name.
18 Here is wisdom: Let the one having reason count the number of the beast, for it is the number of a man and its number [is] six hundred [and] sixty six (or 616). (Revelation 13 GLT)
Jesus was given a crown of thorns. A corona of spike proteins. The Soldiers braided/plaited/double helixed that crown. This is the US military gene splicing COVID19. That is the fulfilment of Matthew27.
27 Then the soldiers of the governor took Jesus into the governor's palace and gathered the whole body of troops together to him.
28 And disrobing him, they draped him with a scarlet cloak,
29 and they braided/plaited/double-helixed a crown out of thorns and put it on his head and a reed in his right hand. And, kneeling before him, they made fun of him, saying: Good day, you King of the Jews!
30 And they spit upon him and took the reed and began hitting him upon his head. (Matthew 27 NWT)
Then in Mark15 Jesus was given not a crown of thorns - but a thorny crown (in the Greek). That is a VARIANT of COVID19.
16 And the soldiers led him away into the hall,
called Praetorium; and they call together the whole band.
17 And they clothed him with purple, and platted a crown of thorns, and put it about his [head],
18 And began to salute him, Hail, King of the Jews!
19 And they smote him on the head with a reed, and did spit upon him, and bowing [their] knees worshipped him. (Mark 15 KJV)
So yes, the flu mutates. But both COVID19 and one of the variants were man made. Steve Hilton on Fox news now carries that story. But the real worry is the 3rd account of the crown of thorns in John19. For in Matthew27 and Mark15 the soldiers SPIT upon Jesus - which is how coronavirus is transmitted. COVID19 and the variants have been transmitted by droplets from the lungs through the mouth. BUT in John19 the soldiers braid/plait/double helix a 3rd crown out of thorns and no spitting occurs. That is COVID21, this year's COVID, which will be more lethal than COVID19, because it is the deadly plague of the 4th horseman of Revelation 6:8. You do not catch it from person to person transmission - no spitting by soldiers. Because it is in the vaccines.
2 And the soldiers braided a crown of thorns and put it on his head and arrayed him with a purple outer garment;
3 and they began coming up to him and saying: Good day,
you King of the Jews! Also, they would give him slaps in the face.
4 And Pilate went outside again and said to them: See! I bring him outside to you in order for you to know I find no fault in him.
5 Accordingly Jesus came outside, wearing the thorny crown and the purple outer garment. And he said to them: Look! The man! (John 19 NWT)
One or more of the vaccines are TROJANS. They cure COVID19 but will eventually cause COVID21 delayed by enough time for most people to get vaccinated. The Oxford Astra Zeneca codes for the plain COVID19 spike. So it is NOT a Trojan. But the Pfizer, the Moderna, the Novavax and the J&J use a stabilised vaccine spike (a mark2 spike). These have the potential to be COVID21. That is why there is so much bad publicity for AZ but very little bad publicity for Pfizer. Whereas Pfizer actually kills 3x more people that AZ according to investmentwatchblog.com.
But none of that is the big picture. The big picture is that at the end of this system God zaps the genes of all the sons and daughters of Adam who are to be saved so that they stop ageing. For Adam was zapped 6,000 years ago so that he started ageing. The COVID vaccines are an attempt to thwart that process. Jesus ransomed Adam. He did not ransom a genetically modified Adam. So if you believe in God at all, if you have any sort of faith. DO NOT GET VACCINATED. My Christian, Jewish, Muslim, Hindu, Bahai, Zoroastrian etc. brothers and sisters, read Genesis 3:15. The final act of Satan is the same as his first act, the first shall be last. Genocide. The vaccines are the snake bite of Genesis 3:15. He will bruise/crush/ambush/bite you in the heel. Two fangs. Two shots. Snake venom can be lethal. DO NOT LET THE SERPENT BITE YOU.
15 And I will put enmity between thee and the woman,
and between thy seed and her seed; it shall bruise thy head, and thou shalt bruise his heel. (Genesis 3 KJV)
15 And I will put enmity between thee and the woman; and between thy seed and her seed. He will wound thy head, and thou wilt wound his heel." (Genesis 3 THOM)
15 And I will put enmity between thee and the woman and between thy seed and her seed, he shall watch against thy head, and thou shalt watch against his heel. (Genesis 3 LXXb)
The Hebrew word translated bruise is ambush/lie in wait for.
The seed of Satan was Cain. Cain in Hebrew means Spear/Needle/Spike. For Satan speared/skewered/pierced Eve to make Cain. Whereas Abel means breath. for Adam kissed Eve before making Abel. The vaccines are an attempt to make you into the seed of Cain/Spear/Needle/Spike. We are in the end times battle of the seeds, the fulfilment of the prophecy of Genesis 3:15. Do not permit your body to be genetically modified. Do not be conned. DO NOT BE NIGH EVE. do not let Cain/Spear/Needle/Spike, turn all your cells into spike/needle/Cain factories!
Do not machine gun your body with man made bio weapon spikes/Cains.
The above is the spiritual situation as we understand it. The US bioweapons facility, a division of Fort Detrick was closed down in August 2019, 3 months before Wuhan, due to a leak. Go figure. Search duckduckgo for Prof Francis Boyle and Dr. David Martin, and Fauci - Wuhan - million dollars for physical confirmation that COVID19 is a man made bio weapon made and funded by the US military.
For more see truebiblecode.com/understanding917.html
Our latest predictions for the 2nd and 3rd fire signs of 1Kings18 which are attacks producing a mushroom cloud over the Hudson in Manhattan and over the Thames around Dartford East of London are 2021Iyyar20/21 (2021May2-4), the 7th 2NC Pentecost or 7th Sabbath thereof and 2021Iyyar27/28 (2021May9-11), the late 2NC Pentecost, or Super Pentecost thereafter. These trigger the end of the 7th world power, the UK/US world power, the two feet of the giant image of Daniel2 and then the 10 toes of Daniel2, the 10 kings with one thought of Revelation17 begin on 2021Sivan14 (May26/27) and run for 10 months precisely to 2022Nisan14 (April15/16), the end of Zoar, the end of Kingdom starter salvation.
Gods Blessings
My Love
Gordon Ritchie
P.S. For the full physical story here please see: https://banned.video/watch?id=608c9532bc90d607217084a8 by Dr Carrie Madej. She is unknowingly or perhaps knowingly describing the demonic takeover that is ongoing. She gives the physical. God gives the spiritual.
For more see U935 and see mRNA
A coronavirus of spike proteins is a CROWN OF THORNS. Corona being the latin for Crown.
The crown of thorns scene when Pilate said: Behold the man, was the last abuse that Jesus suffered before he was led off to be crucified.
Mankind is once again wearing a crown of thorns (COVID19).
This therefore is the last abuse we suffer before the death of Adamic man,
the end of this world, the start of the post adamic Kingdom of God on earth.
We are therefore at the end of the End Times.
The soldiers braided/platted/double helixed the crown of thorns. So it is a gene spliced man/demon made bio weapon.
The soldiers spat upon Jesus. That is how COVID is transferred. So the (demon possessed) military deliberately infected mankind. It was not an accidental leak.
In Mark 15 the soldiers made a thorny crown RATHER than a crown of thorns.
That is a variant of COVID19. They only made one such variant.
In Luke 19 the soldiers braided a crown of thorns and did not spit upon Jesus.
So this is a non transmitted infection. It must therefore be due to the vaccines. The vaccines, therefore, are TROJANS.
27 Then the soldiers of the governor took Jesus into the governor's palace and gathered the whole body/coil together to him.
28 And disrobing him, they draped him with a scarlet cloak,
29 and they braided/plaited/double helixed a crown out of thorns [Corona is a Latin feminine noun meaning crown. So a corona of spike proteins] and put it on his head and a reed in his right [hand]. And, kneeling before him, they made fun of him,
saying: Good day, you King of the Jews!
30 And they spit upon him [how COVID is transferred] and took the reed and began hitting him upon his head
31 Finally, when they had made fun of him, they took the cloak off and put his outer garments upon him and led him off for impaling/crucifixion.
(Matthew 27)
Harvard Medical School in February 2020 first referred to COVID19 as a Crown of Thorns: In February, researchers published the structure of the spike protein, the hallmark protrusions that form the distinctive CROWN OF THORNS that SARS-CoV-2 uses to penetrate host cells. With this information in hand, McMahon and Kruse realized they could try to identify nanobodies that might be able to block the interaction between the spike protein and its target on human cells, a protein called ACE2—found in abundance in cells in the airway - Search for: hms.harvard.edu/news/through-storm
Harvard medical school first called COVID19 a crown of thorns in February 2020. Churches did not see it until later (we did not see it until April 2021). But the crown of thorns of Matthew27, Mark15 and John19 was braided/platted by the soldiers. A plait is a double helix, which is the structure of DNA. The greater soldiers therefore gene splice the crown of thorns. The soldiers then spat upon Jesus. That is how COVID19 is transferred.
Conclusion. COVID19 is man made, actually by the greater soldiers. SO IT IS A BIO WEAPON. Made actually by demon possessed military people to be fair to mankind. And since it was the last thing that happened to Jesus who was called 'the man', mankind must now be at the end of the end times. That means that the prophecy about the seed of the serpent biting end time mankind in the heel is now being fulfilled. That means that the COVID vaccination is the snake bite. The two fangs are the two shots. The vaccination is snake venom. It turns your cells into spike protein factories. Cain, the seed of the serpent, the murderer of Abel, means Spear/Needle/Spike in Hebrew.
So the vaccines turn your cells into Cain factories. This makes you into the seed of the serpent. It changes your genes so that you are no longer Adamic but become Cainian. Jesus ransomed Adam. He did not ransom Cain.
That is the genetic power game we are presently the victims of. The Cainians are not denied salvation. But the serpent extends his authorityover them into the Kingdom of God by this genetic rape.
Jesus stands symbolically for mankind here. Because Pilate said in John19 when referring to Jesus standing in front of the crowds wearing the crown of thorns: Ecce homo, Behold the man, Idou o anqrwpoj, So the last abuse that mankind gets is the Crown of Thorns, which is the Coronavirus of Spike Proteins. We are presently all suffering from that Crown. So we are all in the final stage of the end times. The death of Jesus pictures the absolute end of Adam, the death of those going to Hell and the salvation of those becoming non adamic by Gene Zap (dying to Adam) in the Kingdom of God, the return to Eden, the restoration to mankind of what he lost in Eden, a non ageing body. For God's purpose for man has not changed. It just takes a 6 millennium detour.
5 Accordingly Jesus came outside, wearing the thorny crown and the purple outer garment. And he said to them: Look! The man! (John 19)
45 So also it has been written, "The" first "man", Adam, "became a living soul;" the last Adam a life-giving Spirit. [Gen. 2:7] (1 Corinthians 15 GLT)
During the end times, Jesus is here - for Michael stands up in the Time of the End (Daniel12:1). When Jesus is here to police them (demons do not like the police) so are the demons as they were in his first century ministry. For when he expelled them, they would say: What do we have to do with you, son of the most high God? Here is what they have to do with Jesus: When he is here they are here.
The soldiers braided/platted/double helixed the crown. This is the bible telling us that (actually demon possessed) members of the military gene spliced COVID19.
The soldiers spat upon Jesus: Spitting is how the flu is transferred through droplets of fluid expelled from the mouth. This is the (demon possessed)
military deliberately infecting mankind with COVID19.
You cannot beat your enemy until you know who he is. The demons are here, actually for 2,000 pigs of Mark5 a pig for a day from 2016Heshvan21 (the 2NC Pentecost) to 2022Sivan11 (the 1NC Pentecost).
They have several goals:
1. Destroy love for God - (closing down churches)
2. Destroy love between humans - (COVID regulations, no hugging, face masks,
anti social distancing, no visits to care homes, no visits to dying relatives,
no Christmas etc.)
3. Destroy gender (woke cancellation of male and female)
4. Pervert children (encourage sex change drugs or operations before the age of consent)
5. Turn us into the seed of the Serpent (vaccination gene therapy - fill us with snake venom)
6. Kill sufficiently large numbers of us to frighten us into obeying them
7, Make us feel guilty and submissive (White supremacy slander, manufactured ancestral slave guilt and face masks)
8. Avoid being detected (The camouflaged stealthy serpent moves sideways and ambushes its prey)
9. Prevent us from being saved into the Kingdom of God.
The weapons they will use upon us later this year are:
1. Globalism: The UK/US feet of the giant image of Daniel2 will lose their authority and be replaced by 10 toes, which are the 10 Kings of Revelation17,
for 10 months from 2022Chislev2 to 2022Tishri18, the destruction of the beast 616 days after 2021Shebat2, the end of its 1,000 day chain of Revelation20 from 2019Nisan22, the start of the Dragon's 42 month lease of Revelation12 to 2022Tishri14..
2. Mark of the Beast Compulsion starting on 2022Shebat4, the start of WW3.
3. The 2nd horseman of the apocalypse, WW3, from 2022Shebat4 to 2023Elul4
4. The fear of nuclear war in the Great Tribulation, for unless those days were cut short not all [chosen] flesh would be saved, from 2022Tebbeth24 to 2022Elul4
5. The 3rd Horseman of the apocalypse: Famine - not only in the 3rd world.
6. The deadly plague of COVID21 (resulting from Trojans in the vaccinations)
7. Total exclusion from the economic system, unless you have a Vaccine Passport on Mark Enforcement day 2022Shebat4 (2023January30/31). No one can buy or sell without the Mark of the Beast (the USA escapes this - there are no eagle parts in the sea beast of Revelation13)
The heel of the seed of the woman is the sleepy members of the flock of her end time seed, taking the height of the human to represent time from Adam to today and the distance from the back of the foot to represent awareness in the flock)
15 And I will put enmity between thee and the woman,
and between thy seed and her seed; it shall bruise thy head, and thou shalt bruise his heel. (Genesis 3 KJV)
15 And I will put enmity between thee and the woman; and between thy seed and her seed. He will wound thy head, and thou wilt wound his heel." (Genesis 3 THOM)
15 And I will put enmity between thee and the woman and between thy seed and her seed, he shall watch against thy head, and thou shalt watch against his heel. (Genesis 3 LXXb)
The vaccine is the only candidate for this snake bite. The 2 fangs of the snake are the 2 shots of the vaccine. The end times governments of the world are controlled by the Dragon, the descended demonic administration evicted from heaven by Jesus (Michael) and his angels in Revelation12. The dragon is coercing all of mankind to get its gene therapy through its vaccines. These can now only be the venom of the snake bite. There is no more time during which to be bitten by the snake.
The seed of Satan through Eve was Cain, whose name in Hebrew means spear/needle/spike because Satan pierced the virgin Eve when producing Cain. Whereas Abel means breath, because Adam kissed Eve, when producing Abel. Cain murdered his brother and his character has not changed.
7 If you turn to doing good, will there not be an exaltation? But if you do not turn to doing good, there is sin crouching at the entrance, and for you is its craving; and will you, for your part, get the mastery over it? (Genesis 4 NWT)
7 If you do well, is there not exaltation? And if you do not do well, sin is crouching/lying (in wait) at the entrance; and its desire [is] toward you; but you should rule over it. (Genesis 4 GLT adapted)
7 Is there not, if thou dost well, acceptance? and if thou dost not well, at the opening a sin-offering is crouching/lying in wait, and unto thee its desire, and thou rulest over it.' (Genesis 4 YLT adapted)
So the sin of mass vaccination gene therapy, to turn us all into sons of Cain has been waiting for him until now. Sin was waiting for DNA to be discovered and gene sequencing and gene splicing to become known and gain of function research to occur, so that Cain could be given the opportunity to force his genes upon us, to genetically rape us. He rules over this vaccination sin. It is his sin. And he is the father of all the seed of the serpent. But he does eventually repent and then there is an exultation before the entrance into the Kingdom of God.
The vaccines turn our cells into protein spike factories, Cain/Spear/Spike factories, thorn factories. That is how our genes (DNA or RNA) are changed to remake us as sons of Cain.
The news is not all bad however. Because as we saw in the first century, when the Demons are here, then so is Jesus (to police them - demons do not like the police very much). Indeed they said to him when he was expelling them: What do we have to do with you, son of the most high God? Answer: Whenever the demons are here, Jesus is here too. Jesus died to ransom Adam, not Cain. But his ransom of Adam does apply to even to Cain, because we can become covenant sons of Adam by faith and actually by love.
6 who gave himself a corresponding ransom [to Adam] for all [of mankind] -- [this is] what is to be witnessed to at its own particular times. (1 Timothy 2 NWT)
Banning hugging
Banning smiling (through face masks)
Banning visiting dying relatives
Banning visiting living relatives
Banning visiting friends
Banning visiting non resident partners
Closing down churches
Banning Christmas
Banning outdoor gatherings when there is no significant evidence of COVID transfer resulting from them.
Invalidating gender (indulging woke activism)
Invalidating our ancestors (indulging BLM activism)
Invalidating family authority over children
Permitting sex altering therapy on children below the age of consent for sex
They did not respond like this in 1957 and in 1968 when we had Asian flu pandemics which killed millions of people but reached herd immunity after around 5 months.
Coercing us and our children to take experimental gene therapy is a contravention of the Nuremberg Code on coerced medical experimentation.
So has mankind learned anything from the lethal deception that the Serpent pulled on Eve? Or are we today just as Nigh Eve as she was?
Do you want two fangs worth of snake venom to genetically modify your immune system with man made spike proteins?
Or do you accept that snake venom is generally very bad for your health and can actually be lethal?
15 And I will put enmity between thee and the woman; and between thy seed and her seed. He will wound thy head, and thou wilt wound his heel." (Genesis 3 THOM)
15 And I will put enmity between thee and the woman and between thy seed and her seed, he shall watch against thy head, and thou shalt watch against his heel. (Genesis 3 LXXb)
This prophecy is being fulfilled right now. When a snake bites you it injects snake venom into you. The heel of mankind, is end times mankind, the head was Abel, the first of the good seed. This is the same interpretation that Daniel made of the giant man of Daniel2.
Cain was the first of the bad seed of the serpent. His name in Hebrew means Spear/Needle/Spike. Do not permit his vaccine to turn your cells into spike factories, Cain factories. He wants to genetically modify you, to rape your genes, to turn you into his seed and deny you the salvation of the sons of Adam. In case you do not know it: Satan and Cain are both murderers.
Texas ended lockdowns in March 2021. They had zero COVID deaths today for the first time since March 2020. I now understand that lockdowns and masks prevent herd immunity because they prevent microinfections which are effectively vaccinations. They also weaken the immune system which has led to the increase in children with respiratory diseases. They also increase depression, suicide, alcoholism, obesity, cardio vascular disease etc etc. They are very very bad science. We have the results from Florida, South Dakota and Texas which have no lockdowns. This is no longer conjecture. It is COVID reality. We also have the results from the 1957 and 1968 Asian flu pandemics for which herd immunity was reached after 5 months because there were no lockdowns and no mask mandates.
https://www.technocracy.news/masks-are-neither-effective-nor-safe-a-summary-of-the-science/
Every day that we remain in lockdown SAGE kills more people than necessary in the UK and kills 10x that amount in the 3rd world due to economic deprivation.
Study finds that Mask mandates have zero effect on COVID transmission, that remote learning INCREASES COVID transmission when compared to in person learning and that on site ventilation DECREASES transmission
This paper reports on the correlation of mitigation practices with staff and student COVID-19 case rates in Florida, New York, and Massachusetts during the 2020-2021 school year. We analyze data collected by the COVID-19 School Response Dashboard and focus on student density, ventilation upgrades, and masking. We find higher student COVID-19 rates in schools and districts with lower in-person density but no correlations in staff rates. Ventilation upgrades are correlated with lower rates in Florida but not in New York. We do not find any correlations with mask mandates. All rates are lower in the spring, after teacher vaccination is underway. - https://europepmc.org/article/PPR/PPR344238
President of vote fraud Biden said about the unvaccinated that they will end up paying the price. Not if they have already had the disease they won't. Not if they are asymptomatic they won't. Not if they are young they won't. That is not science, that is a sick and abusive threat. He said on May 18 about vaccination: It’s the right thing to do. It’s the smart thing to do. It’s the strong thing to do. Translation: It is the wrong thing to do, the dumb thing to do and the weak thing to do. https://www.foxnews.com/politics/biden-covid-warning-unvaccinated-paying-the-price
General Lockdowns do prevent infections and death in the short term. But they are no more effective, possibly less effective, than specific lockdowns
General Lockdowns suffer from bounce backs after they are lifted, unless herd immunity is reached during the lockdown.
They Destroy the economy which reduces funding for the NHS in the future and their economic impact causes depression, mental illness, suicide, alcoholism, and drug addition.
Kill many more people in the 3rd world who live on knife edge economic subsistence, than they save in the first world in the short term
Prevent COVID micro infections from short duration person to person interactions which lead to herd immunity. So they prevent herd immunity from being reached or delay it significantly
Weaken the immune system in general by preventing all micro infections
Cause obesity which is dangerous for COVID and cardio vascular disease.
Cause massive collateral damage by preventing patients suffering from major killers such a CHD and Cancer getting the treatment they need when they need it and before it is too late..
Themselves cause suicide, depression, Alcoholism, drug addiction, mental illness
Decrease love between people which manifests itself in more divorce, crime,
corruption, aggression etc.
Split up marriages and destroy relationships between partners.
Lockdowns of children suspend social development and set back their education in a way that may not be fully recoverable.
Florida South Dakota and Texas compared to New York California and Michigan convincingly show with real world data that general lockdowns have either no benefit or are detrimental to short term and medium term COVID numbers
The Great Barrington Declaration advised against general lockdowns from the start of the Pandemic and recommended locking down only the sick and the vulnerable.
Lockdowns of the elderly increase dementia rates and remove one of the main motivations for carrying on.
Lockdowns prevent people exercising their own judgement as to what is dangerous and what is not. Life is about making those judgements, not being prevented from making them.
Lockdowns increase the power of the public sector over the people - which is always extremely dangerous.
But apart from all that what damage have lockdowns ever done to us?
Locking down the infectious and those at significant risk (more than pneumonia) is supported by the science and has been practiced since time.
Locking down the healthy and the those not at significant risk (less than pneumonia) is not supported by science and was invented in 2020 for the purposes of deep state control by fear. It is an abuse of medical quarantine science.
It is a necessary step on the path to a thought police state It is behavioural science not medical science
It is also a means of coercing the vaccine. When you buy a second hand car in the absence of detailed mechanical knowledge you are buying not the car but the trustworthiness of the seller. When you take a lockdown coerced vaccine in the absence of detailed or correct medical knowledge you are taking not the vaccine but the trustworthiness of an abusive government into your body.
I would like to present the law of Imperial capability which my nephew and I developed last night in the curry shop. A law that would never have been formulated had the lockdown not been ended. So thanks for that one Boris!
This law states that when mankind develops the capability to make an empire for himself, someone will make that empire - because he can. History, which is presently being erased, shows this law to have been true in the past.
1. Mankind today has the capability to hack the immune system (quoting the CEO of Moderna). So someone will do that and create an empire from it. An empire over the hacked, the genetically modified, the vaccinated. An empire which controls people through genetics. It is inevitable.
2. Mankind today has the communications, the translation capability, the surveillance capability and the transport capability to make a global government. So we shall have a global government. Globalism will occur. It is inevitable.
3. Mankind today has the IT power to monitor and control every single financial transaction (once cash is abolished) and make a worldwide financial empire. So this will occur. It is inevitable.
Empires of course are rarely in the interest of the conquered. They exist for the aggrandisement of the conquerors. So how to we fight these 3 coming empires? Your decision. But refuse vaccination, don't vote for globalists and recognise the inevitable Mark of the Beast as a fulfilment of scripture when it comes and so put God, humanity and love above money would be my tuppence.
Here is a quote from the UK government: Options for increasing adherence to social distancing measures 22nd March 2020 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/882722/25-options-for-increasing-adherence-to-social-distancing-measures-22032020.pdf
Perceived threat: A substantial number of people still do not feel sufficiently personally threatened. It could be that they are reassured by the low death rate in their demographic group, although levels of concern may be rising(9). Having a good understanding of the risk has been found to be positively associated with adoption of COVID-19 social distancing measures in Hong Kong. The perceived level of personal threat needs to be increased among those who are complacent, using hard-hitting emotional messaging. To be effective this must also empower people by making clear the actions they can take to reduce the threat.
My favourite newspaper has nailed it. Laura Dodsworth has written a book called the state of fear.
Here is a wonderful explanation from her of what the government has been doing to us.
We are most certainly the subject of a behavioural science experiment.
When the government puts out yes Christmas no Christmas yes Christmas no Christmas - this is not incompetence it is behavioural science.
When they say yes holidays, no holidays, yes holidays no holidays likewise. https://www.telegraph.co.uk/news/2021/05/20/life-inside-fear-factory-government-keeps-us-high-alert/
Here it is if the link does not work (I have a subscription)...
Foreign holidays are back! So said the headlines last week when the Government’s “green list” of safe countries was revealed.
Not so fast, warned ministers, telling the public going abroad was “dangerous” and is “not for this year”.
Confused? That’s because you’re meant to be, says Laura Dodsworth, who has spent the past year investigating the Government’s use of behavioural psychology for her new book, A State of Fear.
“When you create a state of confusion, people become ever more reliant on the messaging,” she says. “Instead of feeling confident about making decisions, they end up waiting for instructions from the Government.”
This week’s chaotic and contradictory advice on travel is all part of the growing use of fear to control the public, she believes – a tactic which has been supercharged by the Covid pandemic.
“It reminds me very much of what the Government was doing at Christmas, when family Christmases were on, then off, then back on, then off again,” she says. “You have got someone tightening the screw, then loosening the screw, then tightening it again. It’s like a torture scenario.”
Dodsworth, who is also the latest guest on The Telegraph's Planet Normal podcast, which you can listen to using the audio player above, believes that the technique “infantilises” the public and enables the Government to control behaviour without having to use unpopular legislation – such as making holidays illegal.
It may at first glance have the feel of a conspiracy theory, but in the course of her research Dodsworth has not only uncovered what she says is evidence of the industrial-scale use of behavioural science in Whitehall, but also spoken to practitioners who believe it has gone way too far.
Dodsworth believes inconsistent messaging from the Government helps maintain a state of confusion Credit: ANDREW PARSONS/10 Downing Street/AFP via Getty Images
One told her they were stunned by the “weaponisation” of fear by Whitehall. Dodsworth says: “I fervently hope this book is actually going to inspire a much needed conversation about the use of fear, not just in the epidemic, but the way we use behavioural psychology overall.
“It’s not just a genie that has been let out the bottle. It’s like we’ve unleashed a Hydra and you can keep chopping its head off, but they keep employing more of these behavioural scientists throughout different government departments. It’s very much how the Government now does business. It’s the business of fear.”
Dodsworth set off on her quest after being struck by a now-infamous minute of a Scientific Advisory Group for Emergencies (Sage) meeting last March. It noted that a sub-group of Sage, the Scientific Pandemic Influenza group on Behaviours (SPI-B), had warned that many people “still do not feel sufficiently personally threatened” and that “the perceived level of personal threat needs to be increased”.
This has become “Exhibit A” in the case against the Government’s use of alleged covert psychological strategies – but Dodsworth found multiple branches of the State employing similar methods. There is the Behavioural Insights Team, better known as the “nudge unit”, which has become so successful it is now a semi-independent body advising other countries on how to use nudge theory to the greatest effect.
Less well known is the Home Office’s Research, Information and Communications Unit (RICU), which, according to Dodsworth, “attempts to covertly engineer the thoughts of people” by providing support to bodies seen by the public as “grassroots” organisations.
There is also the Rapid Response Unit, based in Number 10 and the Cabinet Office, and the Counter Disinformation Cell, attached to the Department for Digital, Culture, Media and Sport, both of which monitor social media and tackle “fake” news including, Dodsworth claims, YouTube videos by doctors who contradict WHO guidance on Covid.
GCHQ has been involved in combating anti-vaccine messaging, Dodsworth suggests, and military personnel, she claims, are also being used to rebut private citizens who challenge lockdown on social media.
She says some people believe they have been targeted by the 77th Brigade, part of the 6th Division of the Army, which, according to the Ministry of Defence, uses “legitimate non-military levers as a means to adapt behaviours of the opposing forces and adversaries”. When she inquired about the activities of some of these bodies, “I hit a brick wall,” she says, “and I find that when someone puts up a brick wall, it’s because that’s where the real story lies.”
Laura Dodsworth has spent the past year investigating the Government’s use of behavioural psychology Credit: Jeff Gilbert
In A State of Fear, Dodsworth claims that there are behavioural insights teams operating within at least 10 Government departments. Her research has made her deeply suspicious of even the most innocent-looking good news story about the Government’s work.
“I interviewed someone who had worked for one of the agencies that works with RICU,” she says. “They explained that, after the London Bridge terror attack, there were lots of bunches of flowers left at the scene, but some of them were delivered ‘officially’ before the emotional outpouring from the public. It was fascinating.
“So when I read newspaper articles saying the nurse who delivered the first vaccination in the UK is backing a national thank you day for key workers, I wonder which Government department is behind it. The idea of having a day where we are all going to be thanking people for the vaccine feels a bit staged – a bit Stalinist, even.”
With the success of the vaccine rollout and the decline in Covid deaths, the Government might have been expected to quietly dial down its use of fear. But Dodsworth believes it is as prevalent as ever. “The Cabinet Office is recruiting three new behavioural scientists this week,” she says. “It’s growing and growing. Right now, I feel we are in a maelstrom of nudge.”
For Dodsworth, A State of Fear appears to be something of a new direction, having made her name as a photographer with her three Bare Reality books, in which she snapped men and women naked and interviewed them about their bodies.
She insists, however, that there is a common thread running through her work. “What I’m interested in is what makes us who we are, and I’m interested in taboos. This is really in keeping with the kind of investigative social documentary work I’ve done.”
Some will feel the use of fear was entirely justified if it meant saving lives Credit: Andrew Matthews/PA Wire
Although she supports the vaccination programme and believes people should be encouraged to get the jab, she believes the Government is going about it in entirely the wrong way: “They like to use the term ‘vaccine hesitant’, which implies that people are hesitating before coming to an inevitable conclusion,” she says.
“They are also fear-bombing people over the Indian variant, then love-bombing the vaccine rollout, using carrot and stick to drive vaccine take-up. People need to be given the facts so they can come to an informed decision, not be demonised.”
Dodsworth accepts that for many people, desperate times call for desperate measures, meaning some will feel the use of fear was entirely justified if it meant saving lives. But what she can’t accept is that fear has been used to control the behaviour of the British people without their consent.
“If this was an experiment in a psychology lab, we would have signed consent forms,” she says. “This has not been given full ethical consideration.
“In the past, there have been calls to consult the public on the use of behavioural psychology, and those calls have come from the behavioural scientists themselves. And yet it hasn’t happened. We haven’t yet been consulted on the use of subconscious techniques which effectively strip away our choices.
“The other problem with fear is it creates collateral damage. We’ve tanked the economy. People have lost their jobs and businesses have closed. One in eight adults have developed moderate to severe depression during lockdown. So I think there were a lot of problems with the politics of fear, but really fundamentally, I think it undermines democracy.”
She does not, however, see any future Government reining in the use of behavioural psychology, as it is popular with all parties.
“Libertarians quite like nudge,” she says. “They like it because it avoids the state having to legally mandate. So, for instance, the Government saying they’re not going to mandate Covid passports, but they won’t stop businesses doing it. Well, it ends up getting you into the same place.
“The Left like nudge because they don’t really seem to trust people to make the right decisions. And, we have to remember, Dominic Cummings said at an event a couple of years ago that the future is behavioural psychology and data analytics. Just look at how elections have been won most recently.”
Dodsworth is fiercely patriotic, but has concluded that, in Britain, “We’re a little bit too biddable.
“We want to be quiet and to be good and to do the right thing. And it’s very difficult to stand out and be different. The herd mentality has been really encouraged through the use of behavioural psychology.
“I think ultimately people don’t want to be manipulated. People don’t enjoy being hoodwinked and they don’t want to live in a state of fear. We maybe need to be a bit bolder about standing up more quickly when something is not right.”
You can hide the truth. You can deny the truth. But you cannot destroy the truth. Truth is not something you believe. Truth is something that is not false. I have in my life believed lots of things that were false and I probably still do. My believing them does not make them true. It just means I think they are true. This stuff is not merely pointless semantics. It is the entire basis of political deception and of solving crime and of scientific research etc.. If you are afraid of insulting liars you represent that there is no truth and that it is all subjective. But that itself is a lie. The truth is always there. But mankind is a master at hiding it and denying it. Worse still we are the victims of deception upon deception. With COVID it is a case of how many layers of deception can you see through?
1. It did not evolve from bats. It is man made from SARS1 HIV1 and HIV2 -
Nobel Laureat Prof Montagnier
2. It was not a lab leak. It was released deliberately to force the vaccine - https://rairfoundation.com/breaking-famous-doctor-develops-safe-vaccine-against-covid-germany-prosecutes-him-video/
3. The Chinese lab is a front for the globalists. It was set up by the French and funded by the US.
4. The vaccine turns you into a profit centre for big Pharma. Due to this and John19 we believe it may be a Trojan (we do not know the truth)
5. The purpose of the exercise is to force vaccine passports. These are not the solution as is represented. They are the Goal of the bio terrorists who released COVID.
6. The vaccines are gene therapy, They reprogram your cells. Too few non biologists understand that.
7. The vaccines hinders your salvation by making you into the seed of the serpent, a son of Cain. they are genetic rape (we interpret - from Genesis 3:15 and the Hebrew meanings of Cain being spear/Needle/Spike)
We can see 7 layers. There may be more.
"Currently, mRNA is considered a gene therapy product by the FDA. Unlike certain gene therapies that irreversibly alter cell DNA and could act as a source of side effects, mRNA-based medicines are designed to not irreversibly change cell DNA; however, side effects observed in gene therapy could negatively impact the perception of mRNA medicines despite the differences in mechanism. In addition, because no product in which mRNA is the primary active ingredient has been approved, the regulatory pathway for approval is uncertain" - https://www.sec.gov/Archives/edgar/data/1682852/000168285220000017/mrna-20200630.htm
AZ and JJ are the DNA Gene therapies that IRREVERSIBLY alter cell DNA - woops! mRNA based medicines are designed to not split infinitives and to nor irreversibly change cell DNA. But we do not know whether they achieve that design goal or not. Depends if there is any reverse transcriptase about.
https://cuttingthroughthefogcom.files.wordpress.com/2021/05/evidence-of-injury-mwm-1.pdf
https://video.foxnews.com/v/6257007407001
Early Intervention Improvement Studies
Proxalutamide 92%
2
Fluvoxamine
89%
2
Budesonide
82%
1
Povidone-Iodine 82%
4 (Aquafresh mouthwash or any mouthwash containing Cetylpyridinium Chloride) -
Bromhexine 79%
2
Ivermectin
78%
23
Vitamin D
78%
3
Bamlanivimab 75%
3
Casiri/imdevimab 68%
3
Hydroxychloroquine 66%
29
Nitazoxanide
49%
5
Zinc
42%
2
Favipiravir
38%
3
Vitamin C
18%
1
Improvement is basically in death rate
https://www.cardiff.ac.uk/news/view/2393858-scientists-call-for-urgent-research-on-potential-for-mouthwash-to-reduce-sars-cov-2-transmission
IVERMECTIN EVIDENCE BASE
Type
Death Reduction Studies Authors Patients
Early treatment 78% [61-88%]
23 236
3,227
Late treatment 45% [27-59%]
20 165
6,595
Prophylaxis 85% [75-91%]
14 108
8,789
Mortality
72% [54-83%] 21
195 7,525
RCTs only 65%
[49-75%] 29
310 5,161
All studies
72% [63-78%] 57
509 18,611
https://twitter.com/robinmonotti2/status/1403215093253480448 - Dr Nyjon Eccles is one of the most respected Integrated Medicine physicians in the UK. He holds a raft of medical and academic qualifications, including the MBBS, and is a Member of the Royal College of Physicians (MRCP). He also holds a PhD in Pharmacology (London).
EVIDENCE BASE used for other COVID-19 approvals
Medication
Studies Patients Improvement
Budesonide (UK)
1 1,779
17%
Remdesivir (USA)
1 1,063
31% (but it has a 25% death rate due to kidney failure)
Casiri/imdevimab (USA) 1
799 66%
Ivermectin evidence 57
18,611 72% [63-78%]
VITAMIN D3 EVIDENCE BASE
Type
Improvement Studies Patients
Early treatment 78% [61-88%] 4
156
Late treatment 56% [34-71%] 11
2,659
Prophylaxis 40% [21-56%]
10 20,424
RCTs only 53% [20-72%]
6 1,412
Mortality
65% [48-76%] 15
9,355
All studies 56% [42-66%]
25 23,625
HYDROXYCHLOROQUINE EVIDENCE BASE
Type
Death Reduction Studies Patients
Early treatment 66% [51-76%]
29 54,350
Late treatment 22% [16-28%]
169 195,191
Prophylaxis 29% [12-47%]
53 127,748
RCTs only 24% [7-38%]
35 18,884
Mortality
25% [18-31%] 156
268,212
All studies 56% [42-66%]
248 382,165
https://rightsfreedoms.wordpress.com/2021/05/29/covid-19-early-treatment-real-time-analysis-of-659-studies/
Here are the 2021September data from the Medicare CMS database of 59.4 million people on Medicare (Medicaid) in the US.
https://twitter.com/YoVince/status/1403414982314786818
The spike proteins cause the coagulopathy.
Not one of the 1359 previously infected subjects who remained unvaccinated had a SARS-CoV-2 infection over the duration of the study - https://www.medrxiv.org/content/10.1101/2021.06.01.21258176v2
(100-Individual Immunity%) x R0 < 100 for the end of a Pandemic and for reaching Herd Immunity.
Latest Herd Immunity Calculation (June16)
R0 for Wuhan Alpha is now said to be 4-5. So we need 75-80% individual immunity for the end of that pandemic
R0 for the Indian Delta is now said to be 5-8. So we need 80-87.5% individual immunity for the end of that pandemic
Conservative Assumption Natural immunity (infected-recovered people symptomatic and asymptomatic + T cell immune people) after 16 months is 50% (normally by now it would be 100% but we have had a lot of lockdowns)
The Amish in the US, who do not take vaccines, reached it in March. Herd Immunity was reached within a year in the 1957 and 1968 Asian Flu and Hong Kong flu pandemics with nothing but Vitamin C. It takes longer this time due to the lockdowns.
Taking: 1 Jab gives 75% immunity. 2 Jabs give 93% immunity
57.4% have had 2 jabs at 93% immunity (93% of 57.4% is 53.4%) plus natural immunity (50% of 7% of 57.4% is 2.0%)
79%-57.4% is 21.6% who have had 1 jab at 75% immunity (75% of 21.6% is 16.2%)
plus natural immunity (50% of 25% of 21.6% is 2.7%)
21% have had no Jabs but have natural immunity (50% of 21% is 10.5%)
So total individual immunity is 53.4 plus 2.0 plus16.2 plus 2.7 plus 10.5 making 84.8% conservatively on June16. So we have certainly reached herd immunity for Wuhan alpha and given the conservative natural immunity figures we will also be there for the Indian delta variant IF THE VACCINES WORK. But they do not. They actually prevent Herd Immunity from being reached. whereas the Amish who take no vaccine practiced no social distancing and wore no masks having had immunity for most of this year - https://www.infowars.com/posts/covid-for-amish-herd-immunity-achieved-with-no-hospitalizations-isolation-or-vaccines/
There is 'the science'. The govt and SAGE are now seen to be science deniers, herd immunity amnesiacs, vaccine pushers and control freaks.
If the pandemic genuinely returns it can only be because the vaccines no longer work.
Dr. Marty Makary of Johns Hopkins has been one of the lone medical professionals trying to bring reason and logic to the COVID pandemic. He lobbed a grenade into the tent by declaring that the US will have herd immunity by April 2021 (true only for Wuhan alpha and true only if vaccines work)..
AZ JJ Pfizer and Moderna vaccines are all gene therapy in the sense that they reprogram your cellular ribosomes genetically to make COVID19 spikes. They do not edit you genome. But AZ and JJ add a second genome to each cell nucleus they infect and mRNA vaccines make you cells behave as if they had a second genome comprising the DNA that the mRNA was transcribed from. The American Society of Gene and Cell Therapy calls then Gene Therapy... https://asgct.org/research/news/november-2020/covid-19-moderna-nih-vaccine
Big Pharma did not develop gene therapy vaccines because they wanted to cure COVID
They developed COVID because they wanted to do gene therapy on everyone.
That is why they deny the vaccines are gene therapy when they reprogram your cells genetically to make spike proteins
That is why they deny Herd Immunity has been reached
That is why they deny natural immunity is better than vaccine immunity
That is why they recommend people with natural immunity get vaccinated - which gives no benefit and greater risk
That is why they deny that any other medical treatment has any proven efficacy against COVID
That is why they seek to vaccinate children when a healthy 13 year old died 3 days after the mRNA vaccine in the US recently with a heart full of spike proteins (Ingraham angle)
That is why the govt locks us down and bans our holidays
"Currently, mRNA is considered a gene therapy product by the FDA. Unlike certain gene therapies that irreversibly alter cell DNA and could act as a source of side effects, mRNA-based medicines are designed to not irreversibly change cell DNA; however, side effects observed in gene therapy could negatively impact the perception of mRNA medicines despite the differences in mechanism. In addition, because no product in which mRNA is the primary active ingredient has been approved, the regulatory pathway for approval is uncertain" - https://www.sec.gov/Archives/edgar/data/1682852/000168285220000017/mrna-20200630.htm
AZ and JJ are the DNA Gene therapies that IRREVERSIBLY alter cell DNA - woops! mRNA based medicines are designed to not split infinitives and to nor irreversibly change cell DNA. But we do not know whether they achieve that design goal or not. Depends if there is any reverse transcriptase about.
http://medisolve.org/yellowcard_urgentprelimreport.pdf
This means that for the young especially who have a greatly reduced risk of COVID death, should not take them. COVID is more dangerous for the old. Vaccines are more dangerous for the young - https://twitter.com/RanIsraeli
One can program a crypto currency to only be valid for certain transactions and thereby control what people buy or from which shops they buy - with their own money! That looks very like the Mark of the Beast of Revelation13.
Researchers with the University of Oxford posted findings on The Lancet’s preprint server Monday, drawing from trial participants aged 18 to 55.
Results suggested a 45-week delay between the first and second dose lent up to an 18-fold increase in antibody response, per data taken 28 days post-
second dose. Antibody levels were four times higher, compared to the 12-week gap. -
https://www.foxnews.com/health/astrazenecas-covid-19-vaccine-stronger-immunity-45-week-gap-company
So 12 weeks is 4x better than 4 weeks and 45 weeks is 18x better than 4 weeks. So the AZ DNA is continually pumping out spikes and the body has to produce more and more antibodies as time goes on. There is the lethality. You are a time bomb producing more and more and more protein spikes.
12 weeks gives 3½x more antibodies than 3 weeks with Pfizer vaccines - The Birmingham study involved 172 people aged 80-99, who each received two shots of the Pfizer vaccine. Of the group, 73 had a 12-week interval between doses and 99 a three-week interval. Peak levels of neutralising antibodies, reached 2-3 weeks after the second jab, were 3.5 times higher on average in the group with the extended gap - https://todaynewspost.com/news/world/uk-news/longer-gap-between-pfizer-jabs-boosts-antibody-response-in-elderly/
This means that the mRNA vaccines have a long term and incrementally increasing effect just as the DNA vaccines do. This means the mRNA must be as persistent as the AZ DNA. Where is the off switch? Vaccines are supposed to prime the immune system and then vanish. They are not supposed to indefinitely produce and larger and larger immune response.
"However, if they call their drugs vaccines, they can bypass the safety studies. All of a sudden, they expect us to believe that all of these safety issues have been resolved? Another problem is related to how long the mRNA remains stable in your system. It’s encased in nanolipid to prevent it from degrading too rapidly, but what happens if the mRNA degrades too slowly, or not at all?" - https://therealtruthnetworkcom.wordpress.com/2021/07/11/how-covid-19-vaccines-may-destroy-the-lives-of-millions/
Latest calculation - apologies for previous mistakes: PHE data for the delta variant for the period from Feb1 to June21 can be found on https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/997418/Variants_of_Concern_VOC_Technical_Briefing_17.pdf
We look only at over 50s to reduce the age dependency of the results - https://www.bbc.co.uk/news/health-55274833
We take the average vaccine status between April15 when delta was first announced and June21, the end of the data, as being that of June1 - - https://coronavirus.data.gov.uk/details/vaccinations
Total deaths 'in any setting' within 28 days of positive specimen date were 109.
Of these
3 were unclassified, 1 was 1 Jab but within 21 days and
0 Jabs: 38 deaths from 976 cases from 3.5m over 50s (15%)
1 Jabs: 17 deaths from 3865 cases from 5.2m over 50s (22%)
2 Jabs: 50 deaths from 3546 cases from 14.9m over 50s (63%)
But these deaths are 'in any setting'. They are WITH COVID rather than FROM COVID. 34.5% of the population of 67.5m = 23.6m is over 50. And 1350 of those die every day from all causes or 'in any setting'. Delta only started being detected significantly around May1.So we have 52 days of death or 70,200 deaths from 23.6m people over 50 from May1 to June21 which is 3 per thousand. So taking out 3 per thousand who would have died anyway, the deaths FROM COVID were
0 Jabs: 38 - 3 = 35 deaths from 976 cases from 3.5m over 50s (15%)
1 Jabs: 17 - 11.6 = 5.4 deaths from 3865 cases from 5.2m over 50s (22%)
2 Jabs: 50 - 10.6 = 39.6 deaths from 3546 cases from 14.9m over 50s (63%)
0 Jabs are 35x63/15x39.6 = 3.71x more likely to die than 2 Jabs
0 Jabs are 35x22/15x5.4 = 9.5x more likely to die than 1 Jab
2 Jabs are 39.6x22/63x5.4 = 2.56x more likely to die than 1 Jab
2 jabs do provide 3x the immunity of 1 Jab (63x3865/22x3546 = 3.12). They are better for case numbers. Better for the NHS.
BUT they are 2.56x more lethal than 1 Jab.
These data say get 1 Jab not 2 for the delta variant. Certainly do not take a booster jab!
They also say that the vaccines work but are toxic and are dosed too highly. I suspect that 1% of a jab would be optimal!
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/997418/Variants_of_Concern_VOC_Technical_Briefing_17.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/997414/Variants_of_Concern_VOC_Technical_Briefing_16.pdf
Delta deaths in the week from June14-June21. Vax status on June 17 was...22% 1 jab and 63% 2 jabs and 15% 0 jabs (at least 21 days previously) - https://www.bbc.co.uk/news/health-55274833
0 Jabs 38-34 = 4 dead from 3.5m over 50s (15%)
1 Jabs 17-10 = 7 dead from 5.2m over 50s (22%)
2 Jabs 50-26 = 24 dead from 14.9m over 50s (63%)
0 Jabs are 4x63/15x24 = 0.70x more likely to die than 2 Jabs
0 Jabs are 4x22/15x7 = 0.83x more likely to die than 1 Jab
2 Jabs are 24x22/63x7 = 1.20x more likely to die than 1 Jab
So in the week from June14-21, the latest published PHE data, you were better off not being vaccinated. And 1 Jab was better than 2 Jabs.
These data are for death with COVID rather than deaths from COVID. There are 23.6m people over 50 in the UK. 1350 of these die every day of all causes. So during 7 days 9450 would die. This is a rate of 0.4 per 1000. Total cases were 976 (0Jabs), 3865 (1Jab), 3546 (2Jabs). So if we deduct those who would have died anyway we get.
0 Jabs 4 - 0.4 = 3.6 dead from 3.5m over 50s (15%)
1 Jabs 7 - 1.5 = 5.5 dead from 5.2m over 50s (22%)
2 Jabs 24 - 1.4 = 22.6 dead from 14.9m over 50s (63%)
0 Jabs are 3.6x63/15x22.6 = 0.67x more likely to die than 2 Jabs
0 Jabs are 3.6x22/15x5.5 = 0.96x more likely to die than 1 Jab
2 Jabs are 22.6x22/63x5.5 = 1.44x more likely to die than 1 Jab
So the best we have for the week from June14-21 from PHE data is that 1 Jab gives the same protection a 0 Jabs. And 2 Jabs make things worse.
24 delta deaths from the doubly vaccinated compared to 4 from the unvaccinated is a total disaster.
Full analysis of PHE (Public Health England) figures for death with genomically confirmed delta variant
Cumulative deaths WITH delta.
Week | All | Delta | n/a | 0Jabs | 1Jab | 2Jabs | Notes |
July6-19 | 415 | 5 | 131 | 59 | 220 | >50s | |
July6-19 | 45 | 1 | 34 | 6 | 4 | <50s | |
July6-19 | 460 | 6 | 165 | 65 | 224 | ||
June22-July5 | 231 | 2 | 71 | 42 | 116 | >50s | |
June22-July5 | 26 | 0 | 21 | 3 | 2 | <50s | |
June22-July5 | 541 | 257 | 2 | 92 | 45 | 118 | |
June 15-21 | 109 | 3 | 38 | 18 | 50 | >50s | |
June15-21 | 8 | 0 | 6 | 2 | 0 | <50s | |
June 15-21 | 278 | 117 | 3 | 44 | 20 | 50 | |
June 8-14 | 169 | 73 | 2 | 34 | 11 | 26 | |
June1-7 | 105 | 42 | 0 | 23 | 7 | 12 | |
May25-31 | 54 | 17 | 1 | 11 | 3 | 2 |
Weekly deaths WITH delta.
Week | All | Delta | n/a | 0Jabs | 1Jab | 2Jabs | Notes |
July6-19 | 184 | 3 | 60 | 17 | 104 | >50s | |
July6-19 | 19 | 1 | 13 | 3 | 2 | <50s | |
July6-19 | 203 | 4 | 73 | 20 | 106 | ||
June22-July5 | 122 | -1 | 33 | 24 | 66 | >50s | |
June22-July5 | 18 | 0 | 15 | 1 | 2 | <50s | |
June22-July5 | 263 | 140 | -1 | 48 | 25 | 68 | |
June15-21 | 36 | 1 | 4 | 7 | 24 | >50s | |
June15-21 | 8 | 0 | 6 | 2 | 0 | <50s | |
June15-21 | 109 | 44 | 1 | 10 | 9 | 24 | |
June8-14 | 64 | 31 | 2 | 11 | 4 | 14 | |
June1-7 | 51 | 25 | -1 | 12 | 4 | 10 | |
May25-31 | 54 | 5 | 1 | 3 | 1 | 0 |
Adjusted PHE data assuming the under 50s figures are correct for June22-July5 and the ratio of <50s to >50s deaths among the unvaccinated does not change from week to week
I wrote to the NHS, PHE Sajid Javid and Sir Patrick just after the June21 figures cane out and told them that their >50s data did not support vaccination. They then altered the frequency of data publication to 2 weeks and "there was an interruption to the data provided to PHE by NHS digital". The number of unvaxxed deaths went 12,11,10 in the previous 3 weeks, then supposedly, 48 in the next 2. Also the ratio of <50 to >50 death in the unvaxxed went from 6:4 to 15:33 which NOT possible. So it is obvious to me that they fixed the >50 figures to favour vaccination but left the <50 figures correct. So we can deduce the correct >50 figures from the <50 figures as follows.
Week | All | Delta | n/a | 0Jabs | 1Jab | 2Jabs | Notes |
July6-19 | 184 | 3 | 10 | 41 | 130 | >50s | |
July6-19 | 19 | 1 | 13 | 3 | 2 | <50s | |
July6-19 | 203 | 4 | 23 | 44 | 132 | ||
June22-July5 | 122 | -1 | 10 | 30 | 83 | >50s | |
June22-July5 | 18 | 0 | 15 | 1 | 2 | <50s | |
June22-July5 | 263 | 140 | -1 | 25 | 31 | 85 | |
June15-21 | 36 | 1 | 4 | 7 | 24 | >50s | |
June15-21 | 8 | 0 | 6 | 2 | 0 | <50s | |
June15-21 | 109 | 44 | 1 | 10 | 9 | 24 | |
June8-14 | 64 | 31 | 2 | 11 | 4 | 14 | |
June1-7 | 51 | 25 | -1 | 12 | 4 | 10 | |
May25-31 | 54 | 5 | 1 | 3 | 1 | 0 |
The above table is corrected from PHEs figures by assuming the >50 deaths after June21 are incorrect after my email to them showing that their June14-21 data did not support vaccination. But they did not touch the <50 deaths and that unvaxxed deaths are just as constant from delta in July as they were in June. Once the vaxxed deaths per capita have overtaken the unvaxxed one would expect that trend to continue.
Here are the latest genetically sequenced delta variant case numbers from PHE for the over 50s only from Technical Briefings 17-23.
0Jabs and 1Jab and 2Jabs
8,551 and 7443 and 71,991 (Technical briefing 23 up to September12)
6724 and 6899 and 51420 (Technical briefing 22 up to August29)
4891 and 6303 and 32828 (Technical briefing 21 up to August15)
3440 and 5835 and 21472 (Technical briefing 20 up to August2)
2337 and 5446 and 13427 (Technical briefing 19 up to July19)
1267 and 4651 and 5234 (Technical briefing 18 up to July5)
976 and 3953 and 3546 (Technical briefing 17 up to June21)
1827 and 544 and 20,571 (TB23-TB22 for the period from August30-September12)
1833 and 596 and 18592 (TB22-TB21 for the period from August16-29)
1451 and 468 and 11356 (TB21-TB20 for the period from August3-15)
1103 and 391 and 8045 (TB20-TB19 for the period from July20-August2)
1070 and 795 and 8193 (TB19-TB18 for the period from July6-19)
291 and 698 and 1688 (TB18-TB17 for the period from June22-July5)
8.0% and 2.4% and 89.7% of cases out of 22942 (TB23-TB22 for the period from August30-September12)
8.7% and 2.8% and 88.5% of cases out of 21021 (TB22-TB21 for the period from August16-29)
10.9% and 3.5% and 85.6% of cases out of 13275 (TB21-TB20 for the period from August3-15)
11.6% and 4.1% and 84.3% of cases out of 9539 (TB20-TB19 for the period from July20-August2)
10.6% and 8% and 81.4% of cases out of 10,058 (TB19-TB18 for the period from July6-19)
Period | 0 Jabs cases % | 1 Jab cases % | 2 Jabs cases % | 2Jabs/0Jabs cases ratio | 2Jabs/0Jabs population ratio | Cases in over 50s |
TB23-TB22 for the period from August30-September12 | 8.0 | 2.4 | 89.7 | 11.2 | 22,942 | |
TB22-TB21 for the period from August16-29 | 8.7 | 2.4 | 88.5 | 10.2 | 8.2 | 21,021 |
TB21-TB20 for the period from August3-15 | 10.9 | 3.5 | 85.6 | 7.9 | 6.8 | 13,275 |
TB20-TB19 for the period from July20-August2 | 11.6 | 4.1 | 84.3 | 7.3 | 6.0 | 9,539 |
TB19-TB18 for the period from July6-19 | 10.6 | 8.0 | 81.4 | 7.7 | 5.0 | 10,058 |
9.7% and 11.0% and 79.3% of people over 50 have respectively 0 and 1 and 2 jabs (5.15m and 5.80m and 41.94m out of 52.89m Adult population on August 23 - assuming over 20s had had enough time to catch up over 50s in jabs if they wish)
11.0% and 14.0% and 75.0% of people over 50 have respectively 0 and 1 and 2 jabs (5.8 and 7.40m and 39.69 out of 52.89m Adult population on August9 - assuming over 20s had had enough time to catch up over 50s in jabs if they wish)
11.8% and 17.1% and 71.1% of people over 50 have respectively 0 and 1 and 2 jabs (6.24 and 9.06m and 37.59 out of 52.89m Adult population on July 27 - assuming over 20s had had enough time to catch up over 50s in jabs if they wish)
13.1% and 20.7% and 66.2% of people over 50 have respectively 0 and 1 and 2 jabs (6.92 and 10.97m and 35m out of 52.89m Adult population on July 12 - assuming over 20s had had enough time to catch up over 50s in jabs if they wish)
UK Govts own data now for 10 weeks in a row show that unvaccinated over 50s are safer, better protected and LESS infectious than vaccinated over 50s. So you are safer in a room full of unvaccinated over 50s than you are in a room full of doubly vaccinated over 50s.
PHE latest data for genetically sequenced delta case numbers for the over 50s..-
https://coronavirus.data.gov.uk/details/vaccinations
Singly vaccinated people do the best of all groups. That is because the vaccines do work at first. But after a few months the initial benefit of the immune system training is outweighed by the damage done to the immune system in general by spike protein overload which according to Cole Diagnostics, the largest independent pathology lab in Idaho, results in a reduction of CD8 killer T cells, which effectively give the vaccinated person a form of AIDS (Acquired Immune Deficiency Syndrome). AIDS itself reduced the number of CD4 Helper T cells.
Doubly vaccinated people at the end of August were 24.4% (10.2 / 8.2) more likely to catch delta than unvaccinated people.
Furthermore it is blindingly obvious that 1Jab is BETTER than 2. That is because the dosages are 1000x too high for vaccination. They are gene therapy doses. And it is because the vaccines damage the immune system more and more each month.
https://www.gov.uk/government/publications/investigation-of-novel-sars-cov-2-variant-variant-of-concern-20201201
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1001354/Variants_of_Concern_VOC_Technical_Briefing_17.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1001358/Variants_of_Concern_VOC_Technical_Briefing_18.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1005517/Technical_Briefing_19.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1009243/Technical_Briefing_20.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1012644/Technical_Briefing_21.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1014926/Technical_Briefing_22_21_09_02.pdf
https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1018547/Technical_Briefing_23_21_09_16.pdf
Here are the latest genetically sequenced delta variant published hospitalisations from PHE for the over 50s only from Technical Briefings 17-23
Figures in terracotta are believed to be rigged
0Jabs and 1Jab and 2Jabs
1199 and 478 and 3747 (Technical briefing 23)
913 and 432 and 2500 (Technical briefing 22)
740 and 391 and 1803 (Technical briefing 21)
491 and 341 and 1098 (Technical briefing 20)
332 and 308 and 672 (Technical briefing 19)
144 and 237 and 264 (Technical briefing 18)
93 and 170 and 122 (Technical briefing 17)
286 and 46 and 1247 out of 1579 (TB23-TB22: August30-September12)
173 and 41 and 697 out of 911 (TB22-TB21: August16-29)
249 and 50 and 705 out of 1004 (TB21-TB20: August3-15)
159 and 33 and 426 out of 618 (TB20-TB19: July20-August2)
188 and 71 and 398 (TB19-TB18: July6-19)
51 and 67 and 142 (TB18-TB17: June22-July5)
18% and 3% and 79.% of emergency admissions out of 1579 (August30-September12)
19% and 4.5% and 76.5% of emergency admissions out of 911 (August16-29)
25% and 5% and 70% of emergency admissions out of 1004 (August3-15)
26% and 5% and 69% of emergency admissions out of 618 (July20-August2)
29% and 11% and 61% of emergency admissions out of 657 (July6-19)
19% and 26% and 55% of emergency admissions out of 260 (June22-July5)
11% and 19% and 70% of people with respective jabs over 50 on July19
10% and 15% and 75% of people had respectively 0/1/2 jabs over 50 on August2
The June22-July5 figures show that 2 Jabs halve your chances of an emergency visit at present. But they used to reduce the chances by more than 5x.
In the 2 weeks to July5, 213 vaccinated people went to emergency and 51 unvaccinated.
The July6-19 figures cannot be correct for 1Jab and 0Jabs. Why would 0Jabs, 1Jab and 2Jabs go up by 269% and 6% and 180% respectively. Sorry the figures are just not credible. 2Jabs increased 30x more than 1Jab??? The Oxford study and Dr Fauci both showed that viral load is the same for the vaccinated and the unvaccinated. So deaths should follow case numbers precisely. Alos the vaccines
Published Deaths in over 50s with genetically sequenced delta
0Jabs 1Jab 2Jabs
437 128 1054 August29 (Technical Briefing 22)
318 93 652 August15
(Technical Briefing 21)
119 35 402
August15-29 (Technical Briefing 22-21)
21% 6% 72% out of 556 deaths (August15-29)
Delta Sequenced Deaths
Week
Total n/a 0Jabs 1Jab 2Jabs
July6-19
415 5
131
59 220 (>50s)
July6-19
45 1
34
6 4
(<50s)
July6-19
460 6
165
65 224
June22-July5 231 2 71
42 116 (>50s)
June22-July5 18 0
15 1
2 (<50s)
June22-July5 257 2
92
45 118
June15-21 109 3
38 18
50 (>50s)
June15-21 8
0 6
2 0 (<50s)
June15-21 117 3
44 20
50
June8-14 73
2 34
11 26
June1-7 42 0
23 7
12
May25-31 17
1 11
3 2
May17-24 12
0 8
2 2
The figures up to June21 show an exponential rise in doubly vaccinated deaths (doubling every week) which would be a disaster if continued. Whereas the unvaccinated deaths were decreasing week on week. Then I pointed out to PHE, NHS, Sajid, Sir Patrick et al that their data did not support vaccination. The result was that PHE changed the frequency of data publication to fortnightly from weekly and "there was an interruption to the data provided to PHE by NHS digital". So we did not get the case numbers until July9.. Also the PHE managed to resurrect an unclassified person twice (the -1s) which is quite impressive. The overall picture now has changed from definitely do not get vaccinated to an incomprehensible and non credible mess which slightly favours vaccination, given that there are now 6x as many doubly vaccinated people as unvaccinated. Also all data prior to June21 show clearly that 1 Jab was better than 2 - which I pointed out to all. The new data does not show that.
I see no reason why the death rate per case from genetically sequenced delta among the unvaccinated over 50s should change in the 2 weeks immediately after I pointed out that their figures do not support vaccination.
If we assume that the unvaxxed per case death rate remains the same from June22 to July5 as it was from May1 to June21 (38 from 976 cases in over 50s with sequenced delta variant) and split the extra vaxxed deaths in the published ratio, then the figures would be.
Week | All | Delta | n/a | 0Jabs | 1Jab | 2Jabs | Notes |
June22-July5 | 122 | -1 | 11 | 30 | 82 | >50s | |
June22-July5 | 18 | 0 | 15 | 1 | 2 | <50s | |
June22-July5 | 263 | 140 | -1 | 26 | 31 | 84 | |
June15-21 | 36 | 1 | 4 | 7 | 24 | >50s | |
June15-21 | 8 | 0 | 6 | 2 | 0 | <50s | |
June15-21 | 109 | 44 | 1 | 10 | 9 | 24 | |
June8-14 | 64 | 31 | 2 | 11 | 4 | 14 | |
June1-7 | 51 | 25 | -1 | 12 | 4 | 10 | |
May25-31 | 54 | 5 | 1 | 3 | 1 | 0 |
Likewise, since I complained only about over 50 deaths, if we assume that PHE have not rigged the under 50 deaths (and failed to separate them out from the total until June15) and use them to deduce the true over 50 deaths from the ratio of 6:4 seen in the week from June15-21 we get
Week | All | Delta | n/a | 0Jabs | 1Jab | 2Jabs | Notes |
June22-July5 | 122 | -1 | 10 | 30 | 83 | >50s | |
June22-July5 | 18 | 0 | 15 | 1 | 2 | <50s | |
June22-July5 | 263 | 140 | -1 | 25 | 31 | 85 |
|
June15-21 | 36 | 1 | 4 | 7 | 24 | >50s | |
June15-21 | 8 | 0 | 6 | 2 | 0 | <50s | |
June15-21 | 109 | 44 | 1 | 10 | 9 | 24 | |
June8-14 | 64 | 31 | 2 | 11 | 4 | 14 | |
June1-7 | 51 | 25 | -1 | 12 | 4 | 10 | |
May25-31 | 54 | 5 | 1 | 3 | 1 | 0 |
These 2 tables are almost identical. So this confirms the correction. To be conservative lets go with the upper table and we see that deaths in the 14 days from June22-July5 were.
0Jabs and 1Jab and 2Jabs
11 and 30 and 82
9% and 24% and 67% of deaths
11% and 21% and 68% of people with respective jabs over 50
So no vaccination (0.82) is safer than single (1.14) or double vaccination (0.99). The data no longer supports vaccination (especially by Astra Zeneca). I suspect that Pfizer is still OK and the problem is mainly Astra Zeneca.
https://www.i24news.tv/en/news/coronavirus/1624888445-israel-has-seen-just-1-death-from-covid-19-in-past-2-weeks-despite-rise-in-cases
The article was dated 2021 June28. So Pfizer is not causing the UK vaccine deaths. It must be the Astra Zeneca shots.
www.renz-law.com has the following letter from a whistleblower...
Vaccines and related biological products advisory committee Meeting September 17, 2021
FDA Briefing document
Although not independently verified by FDA, the post hoc analysis appears to indicate that the incidence of SARS-Cov-2 during the analysis period among 18,727 study participants originally randomized to BNT162b2 (mean of 9.8 months post dose 2 at the beginning of the analysis period) was 70.3 cases per 1000 person years, compared with an incidence of 51.6 cases per 1000 person years among 17748 study participants originally randomized to placebo and crossed over to BNT162b2 (mean of 4.7 months post dose 2 at the beginning of the analysis period). An additional analysis appears to indicate that incidence of COVID-19 generally, increased in each group of study participants with increasing time post dose 2 at the start of the analysis period (i.e. looking at specific time post dose 2 for each participant rather than mean time post dose 2). Only 3 severe COVID-19 cases were reported during the analysis period, all of which occurred among the study participants originally randomized to BNT162b2.
This shows that the vaccines either lose efficacy with time, which is not possible because the immune system does not forget what is what told a few months previously. or that they degrade the immune system - which must therefore be what they do.
A former Pfizer employee, now turned whistleblower, has provided documentation indicating the pharmaceutical giant—whose gene-based COVID-19 vaccine has now been reportedly injected almost 225 million times into the arms of Americans—knows these shots cause recipients to become more susceptible to contracting COVID-19.
On Saturday Karen Kingston, the former Pfizer employee, a pharmaceutical marketing expert and biotech analyst, appeared beside medical freedom rights attorney Thomas Renz in a public meeting. The Ohio-based lawyer has been involved in several major cases brought against federal agencies relating to fraud and violations of medical freedom rights over the last 19 months.
After introducing Kingston, Renz presented the documents she had provided. (See from 17.40 in video.)
- https://www.infowars.com/posts/bombshell-from-attorney-thomas-renz-nearly-50k-medicare-patients-died-soon-after-getting-covid-shot/
Of note is a “Briefing Document” used in a Food and Drug Administration (FDA) advisory committee meeting on September 17, 2021. Titled “Application for licensure of a booster dose for COMIRNATY (COVID-19 Vaccine,
mRNA),” it includes a report on a study conducted by Pfizer testing the longevity of immunity provided by their product over time.
Involving over 36k participants, the main study revealed that the group injected with the regimen earlier were more likely to be infected with the virus than those injected later, indicating a possible “waning of immunity” for the shots. The group injected earlier had a 7% chance of infection in the time period, and those injected later, only a 5.16% rate, equating to the former group having a 36% greater chance of infection than the latter.
In addition, since both groups were measured for the same time period, the latter involving a significant placebo period prior to injection (5.1 months on average), the placebo group was unusually untouched. As Kingston stated in a telephone interview with LifeSiteNews, “There should have been more people infected in the placebo group because they were going on longer without any protection.” She suggested this would therefore seem to indicate that those injected have an even higher chance of being infected with COVID-19 than the 36% difference indicated by this portion of the study.
Extending this conclusion a step further, the document reports, “An additional analysis appears to indicate that incidence of COVID-19 generally increased in each group of study participants with increasing time post-Dose 2.”
In other words, Kingston said, “if you have two doses of Pfizer, your rate for getting infected increases over time.”
Leading to a discovery the biotech analyst called “super alarming,” the report looked exclusively at the placebo group, comparing their rate of infection in the first four months, when they had no protection, to the four months following their injections with the Pfizer product.
During that initial placebo period, the document reports that the infection rate of this group was “12.6 cases per 1,000 person-years,” which equates to a 1.3% infection rate. Following their injections, there were “43.4 cases per 1,000 person- years” or a 4.34% infection rate.
“So, when they weren’t injected, their infection rate was 1.3%, and when they got injected, it was 4.34%. It went up by over 300%,” Kingston stated.
“They had less infection when they had no protection. So, that’s a problem.”
- https://www.lifesitenews.com/news/if-you-get-the-pfizer-vax-youre-more-likely-to-get-covid-insider-leaks-fda-study/?utm_source=featured&utm_campaign=usa
Editor: Mind you we are not comparing like for like here. It all depends upon when the delta variant came along? If it appeared around the crossover time, then it could have caused the increase in infections.
Sajid Javid, the UK minister for health has COVID on July17, after 2 Astra Zeneca Jabs. His was not a reinfection, but reinfection rates for delta have been increasing exponentially by 77% per week from April18 (4) to May30 (127). 4 then 7 then 13 then 21 then 46 then 66 then 127. Then PHE stopped publishing them presumably because they revealed that one of the vaccines is no longer effective. The Cleveland Clinic Study showed that naturally immune people do not get reinfected. So all the reinfections occur in vaccinated people only. Israel has 5 deaths in the last 2 weeks out of 10m. We had 500 out of 67.5m. Israel took Pfizer. We took mainly Astra Zeneca. The inescapable conclusion is that AZ is no longer effective against Delta and this 3rd wave is entirely due to the failing of AZ. Sajid is the high profile proof that even PHE cannot cover up.
Delta deaths are also rising by 77% per week (from PHE technical briefings 14-18). These deaths must therefore be almost entirely due to AZ.
Vaccines have worked well at imparting immunity and at reducing hospitalisations and not quite so well at reducing deaths. But my worry which is now confirmed with AZ is that they are slow burning trojans which eventually kill you by filling your body up the spike proteins and putting a larger and larger load onto your immuine system so that you end up rather like an HIV patient.
Since AZ produces an 18x larger antibody response with 45 weeks between jabs than it does with 4 weeks between jabs, it is apparent that it is doing something more and more as time goes on. All it can do is program your cells to make spike proteins. So you must be making more and more spikes which your immune system has to get rid of. So I suspect that after 3 months 25% of your immune system is used up, then after 6 months 50% the after 9 months 75%, then woops. I think it is inordinately dangerous. Pfizer produces 3.5x as many antibodies with a 12 week gap as it does with a 4 week gap. So I worry that Pfizer will also fill you up but perhaps at a slower rate. I think a whole new branch of medicine will now have to be developed in order to cure people becoming ill and dying from 'safe' vaccines.
The CDC just released a new study showing that Barnstable County Mass. has caught up with the UK and with Israel already !
In Barnstable county Massachusetts during July there were 469 cases of COVID, 74% of which were fully vaccinated in circumstances where 69% of the population were vaccinated.
So being doubly vaccinated increased the chances of catching COVID by 74/69 = 1.07 i.e. 7%.
So now UK and Israeli and US figures are all saying the same thing. The vaccines increase the chances of delta transmission. So a vaccine passport is totally pointless and in fact counterproductive. You are better off in a night club full of unvaxxed people than you are in a club full of doubly vaxxed -
https://www.cdc.gov/mmwr/volumes/70/wr/mm7031e2.htm?s_cid=mm7031e2_w
May UK vaccinated deaths were 31% of total 16 (PHE delta sequenced only)
July UK vaccinated deaths were 69% out of 410 (PHE delta sequenced over 50s only)
Extrapolate that momentum forward to September and vaccinated deaths will be close to 100% of the total.
The CDC recently admitted that PCR test is very inaccurate and is being phased out.
1, Vitamin D 4,000 IU per day prior to infection and more during infection
2. Aquafresh or any Cetylpyridinium Chloride mouth wash ASAP after possible exposure and continue as long as cough persists - https://www.cardiff.ac.uk/news/view/2393858-scientists-call-for-urgent-research-on-potential-for-mouthwash-to-reduce-sars-cov-2-transmission
3. Glutathione reduces the cytokine storm. You can take it as a supplement.
Young people have more Glutathione than old people. That may be partly why they are less susceptible to COVID.
4. Budesonide inhalers
5. High dose intravenous Vitamin C or 500 mg 4x per day
6. High dose Zinc (30 mg per day) with Quercetin (500 mg per day)
7. N-Acetylcysteine, NAC (an immune helper) - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7649937/
8. Nigella Sativa: https://www.youtube.com/watch?v=SOwa6-EOohI
For a great presentation on monoclonal antibody and drug treatment and herd immunity and natural immunity and the failure of US COVID policy to prevent hospitalisation and death by Dr Peter McCulloch please see this video - https://www.bitchute.com/video/FmvgvBfi71T0/
9. Z-Stack pills from Dr Vladimir Zelenko. His results show that these pills prevent 84% of COVID deaths. That means they are more effective than the vaccines were initially. The vaccines are now (2021August) ineffective. https://zstacklife.com/products/z-stack
Vitamin C, Vitamin D3 Zinc and Quercetin are all commonly available supplements. So Dr Zelenko recommends the above quantities once per day as a prophalactic (before catching COVID-19). If you catch COVID, then perhaps double the dosage.
This daily regime will also help avoiding the cytokine storm caused when a person vaccinated over 5 months ago is challenged with any virus attack. So it is a good insurance policy against vaccine damage.
10. Get an Ivermectin prescription if you can...The head of the Tokyo Metropolitan Medical Association has urged doctors and Covid-19 patients to begin a regimen of ivermectin, which he says is effective at treating and preventing the virus.
During an August 12 press conference, Dr. Haruo Ozaki called for the drug, which is proving effective in numerous studies, to be used due to the drastic rise in Covid cases.
“In Africa, if we compare countries distributing ivermectin once a year with countries which do not give ivermectin…I mean, they don’t give ivermectin to prevent Covid, but to prevent parasitic diseases…but anyway, if we look at Covid numbers in countries that give ivermectin, the number of cases is 134.4 per 100,000, and the number of death is 2.2 in 100,000.”
“Now, African countries which do not distribute ivermectin: 950.6 cases per 100,000 and 29.3 deaths per 100,000,” Ozaki highlighted.
“I believe the difference is clear.” - https://www.infowars.com/posts/now-is-the-time-to-use-ivermectin-tokyos-medical-assoc-chairman-recommends-ivermectin-to-all-doctors-to-treat-covid/
"Ivermectin is one of the World Health Organization’s Essential Medicines. With total doses of ivermectin distributed apparently equaling one-third of the present world population. Ivermectin at the usual doses (0.2–0.4 mg/kg) is considered extremely safe for use in humans. In addition to its antiparasitic activity, it has been noted to have antiviral and anti-inflammatory properties, leading to an increasing list of therapeutic indications." - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8248252/
It is incredible that a drug given to a third of the planet which is considered by the WHO to be ESSENTIAL is systematically ignored by Western Governments.
https://pubmed.ncbi.nlm.nih.gov/33113270/
https://www.youtube.com/watch?v=jnpAc-quMAQ
Moderna has 48 trillion copies of spike protein mRNA in 100 micrograms
Pfizer has 14.4 trillion copies of spike protein mRNA in 30 micrograms
Calculation for how many mRNA molecules are in a single vaccine shot?
The vaccines encode the full viral SARS-COV-2 spike protein which is a 1273 amino acid protein. So the an mRNA for it is 3819 nucleotides (each amino is coded by 3 nucleotides). The average molecular weight of a nucleotide in a long RNA chain is about 330 Daltons. With that, we can do the following calculation:
1273 amino acid spike x 3 nucleotides per amino acid x 330 Daltons per nucleotide = 1.26 million Daltons = 1260 kg/mole
There are 0.6022 trillion trillion molecules in 1 mole (Avogadros number). So 1 copy of spike protein mRNA weighs
1260 kg/mole / 0.6022 x 10^24 copies/mole = 2.1 x 10^-18 grams
Thus, 100 mcg of Spike protein mRNA (Moderna) should contain
1 x 10^4 g / 2.1 x10^-18 g/copy = 0.48x10^14 = 48x 10^12 (48 trillion)
copies
Whilst 30 mcg (Pfizer) contains about 14.4 trillion mRNA copies.
The total length of SARS-CoV-2 S is 1273 amino acids - https://www.nature.com/articles/s41401-020-0485-4
However in actuality, RNAs are usually large compared to the proteins they encode due to:
(i) each RNA having three nucleotides for each amino acid encoded (in addition there are 5΄ and 3΄ untranslated RNA sequences)
(ii) the average nucleotide is three times the mass of an amino acid (≈330 Daltons and ≈110 Daltons respectively) -
https://europepmc.org/article/PMC/5389542
Therefore each Moderna vaccine has enough mRNA to infect every cell in your body.
The human body has 30-37 trillion cells in it (wikipedia), The moderna vaccine has 100 micrograms of spike protein mRNA in it which is 48 Trillion copies (since the spike protein has 1273 amino acids and there are 3 nucleotides per amino acid and each nucleotide weighs 330 Daltons which is 330 grams per mole and since there are 0.6022 trillion trillion copies per mole (avogadros number - I personally wish he had not been born).
Pfizer has 14.4 trillion copies of the spike protein mRNA gene (30 micrograms of spike protein mRNA).
Anyone who thinks that being injected with more copies of the spike protein mRNA gene than he has cells in his body is not gene therapy has been thoroughly deceived.
The Lords Witnesses understanding that these vaccines are the snake venom of Genesis 3:15 and therefore reprogram your cells to be Cainian rather than adamic (sons of Cain rather than sons of Adam, sons of Satan rather than sons of God) now appears feasible.
One dose (0.5 ml) of the Oxford Astra Zeneca vaccine for Vaccitech contains:
"
COVID-19 Vaccine (ChAdOx1-S* recombinant) 5 × 1010 viral particles (50 Billion copies of spike protein DNA)
Recombinant, replication-deficient chimpanzee adenovirus vector encoding the SARS CoV 2 Spike (S)
glycoprotein. Produced in genetically modified human embryonic kidney (HEK) 293 cells.
This product contains genetically modified organisms (GMOs)."
https://www.cambridge-news.co.uk/news/uk-world-news/covid-19-what-ingredients-oxfordastrazeneca-19538759
These are hard to see but have been detected by elevated D-dimer levels - https://citizenfreepress.com/breaking/dr-charles-hoffe-issues-vaccine-warning/
https://forbiddenknowledgetv.net/how-the-jab-works-why-it-causes-blood-clots-at-a-microscopic-level/
Dr Charles Hoffe has been practicing medicine for 28 years in the small, rural town of Lytton in British Columbia, Canada and he has administered about 900 doses of the Moderna experimental mRNA injection and is now coming forward to warn about the severe reactions he’s observed in his patients, including death. This resulted in his being fired from his job at the local hospital.
He tells host, Laura Lynne that the core problem he’s seeing among these patients is microscopic clots in his patients’ tiniest capillaries, of which Clif High has commented, “Blood clots occurring at a capillary level. This has never before been seen. This is not a rare disease. This is an absolutely new phenomenon.”
Dr Hoffe explains that these micro-clots are too small to show up on CT scans,
MRI, etc and can only be detected using the D-dimer test, of which 62% of his own patients injected with an mRNA shot are positive.
“We now know that only 25% of the ‘vaccine’ injected into a person’s arm actually stays in your arm. The other 75% is collected by your lymphatic system and literally fed into your circulation so these little packages of messenger RNA, and by the way in a single dose of Moderna ‘vaccine’ there are literally 40 trillion mRNA molecules. These packages are designed to be absorbed into your cells. But the only place they can be absorbed is around your blood vessels and the place where they are absorbed is the capillary networks – the tiniest blood vessels where the blood flow slows right down and where the genes are released. Your body then gets to work reading and then manufacturing trillions and trillions of these spike proteins. Each gene can produce many, many spike proteins. The body then recognises these are foreign bodies so it makes antibodies against it so your are then protected against COVID. That’s the idea.
“But here’s where the problem comes. In a coronavirus that spike protein becomes part of the viral capsule. In other words it becomes part of the cell wall around the virus. But it is not in a virus. It is in your cells. So it becomes part of the cell wall of your vascular endothelium. This means that these cells which line your blood vessels, which are supposed to be smooth so that your blood flows smoothly now have these little spikey bits sticking out…
“So it is absolutely inevitable that blood clots will form because your blood platelets circulate round your blood vessels, and the purpose of blood platelets is to identify damaged vessels and stop bleeding. So, when the platelet comes through the capillary it suddenly hits all these COVID spikes and it becomes absolutely inevitable that blood clots will form to block that vessel.
“Therefore, these spike proteins can predictably cause blood clots. They are in your blood vessels (if mRNA ‘vaccinated’) so it is guaranteed. Dr Bahrdi then said to me that the way to prove this is to do a blood test called a D-dimer blood test.
“The blood clots we hear about which the media claim are very rare are the big blood clots which are the ones that cause strokes and show up on CT scans,
MRI, etc. The clots I’m talking about are microscopic and too small to find on any scan. They can thus only be detected using the D-dimer test…
“The most alarming part of this is that there are some parts of the body like the brain, spinal cord, heart and lungs which cannot re-generate. When those tissues are damaged by blood clots they are permanently damaged.”
The result, says Dr Hoffe, is that these patients have what is termed Reduced Effort Tolerance (RET) which means they get out of breath much easily than they used to. It is because the blood vessels in their lungs are now blocked up. In turn, this causes the heart to need to work harder to try to keep up against a much greater resistance trying to get the blood through your lungs.
This is called pulmonary artery hypertension – high blood pressure in the lungs because the blood simply cannot get through effectively. People with this condition usually die of heart failure within a few short years.
Dr Hoffe warns sadly, “These shots are causing huge damage and the worst is yet to come.”
“What we learned that’s new … is that when you look at the level of virus in the nasopharynx of people who are vaccinated who get breakthrough infections, it’s really quite high and equivalent to the level of virus in the nasopharynx of unvaccinated people who get infected,” Fauci said in an interview with CBS News’ “Face the Nation” on Sunday. The nasopharynx is part of the nasal cavity near the back of the throat https://www.theepochtimes.com/fauci-amount-of-covid-19-in-breakthrough-delta-cases-almost-identical-to-unvaccinated_3929532.html
Therapies to combat vaccine spike protein production...
Hydroxychloroquine and ivermectin treatments. Ivermectin appears particularly promising as it actually binds to the spike protein. Please listen to the interview that Brett Weinstein did with Dr. Pierre Kory,19 one of Dr. Paul Marik’s collaborators |
Low-dose antiretroviral therapy to reeducate your immune system |
Low-dose interferons such as Paximune, developed by interferon researcher Dr. Joe Cummins, to stimulate your immune system |
Peptide T (an HIV entry inhibitor derived from the HIV envelope protein gp120; it blocks binding and infection of viruses that use the CCR5 receptor to infect cells) |
Cannabis, to strengthen Type I interferon pathways |
Dimethylglycine or betaine (trimethylglycine) to enhance methylation, thereby suppressing latent viruses |
Silymarin or milk thistle to help cleanse your liver |
The phenomenon of Herd immunity exists because natural immunity and non gene therapy vaccination immunity (polio, BCG, MMR etc) are long lasting. The immune system does not forget the lessons it has learned. Gene therapy immunity is quite strong at first but vanishes entirely around 4-5 months after the 2nd Jab as the latest PHE Technical Briefing 18/19/20 figures and the CDC Barnstable study show. This is not because the vaccines lose efficacy. Their job is to train the immune system and they succeed in doing that as the short term results show. The loss of immunity is because they also progressively month on month damage the immune system and that damage overtakes the benefit of the initial immunization 4-5 months after the 2nd Jab. It is not because the immune system forgets what is was told 5 months earlier. It is because the vaccines eventually do more harm than good to the immune system. That is why the govt is pushing them so hard. It needs to get everybody vaccinated before it becomes too obvious that the vaccines are a short term immunity boost combined with a medium term immunity compromiser.
The PHE death figures quoted by John Roberts in the Daily Telegraph for the end of July are rigged by PHE in my understanding. I wrote to them in July telling them their death figures for June15-21 (Technical briefing 17-16) show that sequenced delta deaths among the doubly vaxxed PER CAPITA (24 deaths from 63% doubly vaccinated) were greater than those among the unvaxxed (4 deaths from 15% unvaccinated) per capita. things have not got better with vaccines since then.
The vaccines are known to be deteriorating in efficacy with time. And Fauci recently admitted that the severity of infection detected in the doubly vaccinated is now identical to that in the unvaxxed. You are being lied to by PHE. And its not the first time.
I wrote to PHE in late June and told them their figures no longer supported vaccination. They did not respond in writing to my email (having responded to my previous email no problem). Instead, they stopped producing the figures on a weekly basis and changed them to be fortnightly and rigged the over 50s death rates. But they failed to rig the under 50s death rates from which it was still possible to deduce the correct over 50s death rates. I wish I had kept my mouth shut until they had produced more correct figures. But Fauci and the general deterioration in vaccine efficacy with time against delta has now confirmed it anyway.
So with all the credibility of a Cambridge maths scholar, who is NOT employed by the govt I can tell the readers of this paper that doubly vaccinated death rates will be greater per capita today than unvaxxed death rates since the tipping point was the week of June15-21 and vaccines are becomng less and less effective by the day against delta. PHE is deliberately hiding this in order to misinform people into taking a jab which will increase their chances of being killed.
Modernas own website at https://www.modernatx.com/patents
shows the following 7 patent filings for their gene therapy mRNA-1273 (amino acid chain) vaccine...
US 10,703,789 filed January 12 2019
US 10,702,600 filed February 28 2020
US 10,577,403 filed June 12 2019
US 10,442,756 filed December 18 2017
US 10,266,485 filed June 11 2018
US 10,064,959 filed April 21 2017
US 9,868,692 filed July 27, 2017
The 2nd patent, filed on February 28 2020 was a continuation of an earlier patent application number 16/368,270 which was filed on March 28, 2019
So they had all 7 patents applied for by June12, 2019, which is quite impressive given that the WHO was only informed of a pneumonia type outbreak in Wuhan on December 31, 2019.
So all the patents needed to protect Moderna's particular vaccine monopoly were applied for more than 6 months before the outbreak of the disease that the vaccine is supposed to be curing.
This proves that the purpose of the 'lab leak' was to make a market for pre-existing vaccines in the case of Moderna. The leak occurred to force people to have to take the vaccine.
High dose intravenous Vitamin C
High dose vitamin D
High dose Zinc
Quercetin or Hydroxychloroquine or other zinc cell door opener
NAC (an immune helper)
Budesonide
Is far more effective than the 341 page protocol from NIH and Anthony Fauci - https://www.infowars.com/posts/top-talk-show-host-fought-hospitals-covid-protocol-to-save-husbands-life/
Israel is the canary in the coalmine for vaccination efficacy, having been the fastest country in the world to get vaccinated (62% are double jabbed). Only 8% of Palestinians are double jabbed. So the two nations provide a perfect control experiment The graph below is really a vaccinated versus unvaccinated comparison. It shows the vaccine (exclusively Pfizer) working wonderfully from March to July and then failing spectacularly in July and August. Right now you are better off being Palestinian than Israeli which has a poignant irony given the racist vaccination rollout. Truly those last will be first and those first last.
What is happening is that the initial benefit to the immune system of the training received by the initial spike production, becomes overtaken by the general damage done to the immune system by incessant protein spike production around 4-5 months after the 2nd Jab. Below are cases per millions and the deaths per million for both groups. So the vaccines did initially help the Israelis avoid COVID cases and deaths. But they now make things considerably worse in both regards. The reason that Palestinian cases are going up is that they are being infected by vaccinated Israelis. What they need is an non vaccinated Passport. That is not a joke.
Here are the graphs of COVID cases (7 day average) and deaths (3 day average) per million population against time from -
https://ourworldindata.org/covid-cases
Here is the situation as of 2021September14
It is so obvious that the 62% double jabbed Israelis in Green are leading the 8% double jabbed Palestinians in Blue in both cases and deaths. The vaccinated are infecting the unvaccinated. What is needed in Israel is a certificate of unvaccination. Also the vaccines cause twice as much COVID death per million of population as being unvaccinated. But then the vaccines cause all sorts of other deaths too. It is a total disaster. The first wave in Israel at the end of 2020, killed more Palestinians than it did Israelis per head of population. Then the vaccines were introduced mainly in Israel, and the second wave killed around 25% more Israelis than it did Palestinians per head of population. The 3rd wave can therefore be expected to kill over 50% more Israelis than Palestinians per head of population. What this means is that being vaccinated increases your chances of being killed by COVID by 50% This is known as of 2021September2.
The UK doubly vaccinated rate is 66%. The Indian doubly vaccinated rate is 20%. The UK uses no Ivermectin. India uses it extensively. Here is the comparison of our case numbers by John's Hopkins from https://ourworldindata.org/covid-cases
Dr Michael Yeadon, the Vice President of Pfizer (10 years ago) with PhD in respiratory pharmacology having done a degree in biochemistry and toxicology, points out that no COVID variant is more than 0.3% different in amino acid chain composition from Wuhan Hu1 which contains 10,000 amino-acids (30,000 nucleotides in the viral RNA) and is quite a large virus. He then deduces that the public should not be scared at all by new variants because the immune system will treat them no differently from the original strain. The immune system cuts up virus proteins into a hundred or so components and then creates antibodies for each component. So changing 0.3% of a virus will not affect your immune response very much (depending upon the distribution of that 0.3% and the sensitivity of the match between antigen and antibody). That is potentially true for natural immunity. Vaccine immunity is a response only to the protein spike, not to the entire virus. The protein spike contains 1273 amino acids. So even if the entire 0.3% variation occurs in the spike, the change to the spike would be 2.36%, which may not be enough to evade the immune system on the face of it. But the version of SARS which infects only bats has 96% of the genetic material of COVID-19 and it is not infectious to humans at all.
Dr Yeadon argues that both vaccine conferred immunity and natural immunity are independent of variants which are in psychological terms - scariants and in immunological terms - sameiants. However small mutations can make immunological sameiants a lot more infectious - as we have seen with the Delta variant. Yeadon would argue that the immune response to delta should be be no different to that for Wuhan alpha. Yet variants are known to be less lethal and more infectious that the original strain in pandemics. So the small percentage differences in genomes can lead to massive immunological differences. So I am not entirely convinced. It seems to me that some people who were immune to the alpha variant are not necessarily immune to delta.
His video is nonetheless really informative and a must watch from a highly qualified industry insider with a conscience - https://www.thelastamericanvagabond.com/michael-yeadon-interview-former-pfizer-vp-speaks-out-on-dangers-of-mrna-vaccines-covid-illusion/
However it was not known (on April 11) that doubly vaccinated people in July/August became no better at resisting infection or fighting infection that unvaccinated people. This is not due to vaccine immunity failing. It is not due to your T cells forgetting what they learned a few months ago. It is due to immune system disruption caused by incessant vaccine mediated spike protein production. So Dr Yeadon argued in April that vaccination for those over 70 was a worthwhile risk. But that booster shots for new variants are absolutely not worth having for anybody. Whereas today vaccines are shown by real world figures to provide no benefit at all 4-5 months after the 2nd jab.
Dr Yeadon argued in April11, correctly, that the only logical purpose for boosters and vaccinating the young is global depopulation. But now (in August) with the delta variant, the young appear to be getting it more than the old. He predicts worldwide vaccine Passports and says the way to resist is not to get vaccinated. Please watch the video remembering it was made on 2021April11. For more warnings from doctors please see - https://www.infowars.com/posts/youll-refuse-the-covid-vax-after-you-hear-what-these-doctors-have-to-say/ and https://doctors4covidethics.org/blog/
An NHS Nurses Resignation Letter...
Dear Ms Sutcliffe and all Executive Directors,
I write to you today as a highly experienced nurse with 27 years service, to inform you that when my registration expires on 31.05.2021 I will not be renewing it and therefore I am resigning my registration and leaving the profession.
The reasons for this are many but to summarise I am utterly dismayed and disheartened by my profession and with you as our governing body at the complete lack of integrity that has been displayed since the beginning of the ‘Covid19 Crisis’.
The facts about the reality and truth of this alleged crisis are readily available for anyone to find and investigate for themselves, not least you, a body that should have been doing just this, seeking the truth and advocating for both your members and our patients, past, present and future. We are patient advocates not government puppets.
Under the guise of ‘Covid19’ (which has never been isolated or purified) a massive injustice has been served onto the people of this country and globally. It was and remains our duty as healthcare professionals to learn the truth and to be the voice of these people, yet there has been a deafening silence and a sickening desire to simply comply by you and so many of my colleagues that I can not and will not condone. Sadly in these times, for me to speak out about these injustices and to be a true advocate for my patients has meant me being bullied and ostracised by my colleagues, removed from clinical practice by hospital management who state they are unable to consider any evidence presented to them that questions the official narrative and state that they must simply comply with government ‘guidance’ regardless of any harm they may cause.
When did our profession cease to be based on evidence? When did we become order followers uninterested in the facts on which we base the care we give and devastatingly now on which we deny patients and their families care? To speak out about the many 1000s of people in this country alone that have had treatment and investigations delayed or have been left to die, has meant me living in constant fear of being ‘struck off’ the register for simply doing what I swore to do, speak and act for the benefit of my patients at all times.
I refer below to the first part of our code of conduct.
“Prioritise People “
You put the interests of people using or needing nursing or midwifery services first. You make their care and safety your main concern and make sure that their dignity is preserved and their needs recognised, assessed and responded to. You make sure that those receiving care are treated with respect, that their rights are upheld and that any discriminatory attitudes and behaviours towards those receiving care are challenged”.
NMC Code of Conduct
This no longer seems to be at the forefront, of too many of my nursing and medical colleagues, minds and motives. I have witnessed personally and professionally many examples of the above ethos being completely disregarded and have been informed by patients and friends of their own experiences where their holistic needs have been disrespected and disregarded because ‘Covid19’ is a priority over, it seems, every other illness, and, a priority over the emotional, psychological and spiritual well being of both our patients and their families. Any nurse who can deny a child their families being with them when they are sick or dying totally contradicts the entire foundations of our profession, care. As does any nurse who denies end of life patients spending precious time with their loved ones, denying them entry into hospices for fear of ‘Covid’ transmission. Enforcing these restrictions rigidly and brutally, making families say their last goodbyes via the internet or knowing that families have slept in hospital/hospice carparks just so that they can feel close to their loved one at the time of death, because we have removed their right to hold their hands and be with them as they pass. The trauma that this must have caused people is unforgivable and not something I will ever condone and nor should you or anyone in our profession.
The devastating isolation of residents in care homes was, in my opinion, inhumane. It is equally unforgivable and unthinkable that such treatment could ever have been perpetrated by staff who allege to care for these people. The emotional trauma they and their families must have suffered is irreparable and I am ashamed to be associated with a profession that claimed this was to protect them. Holistic care now seems to be a thing of the past as does an individuals right go choose.
Mask exempt patients have been denied treatment in A&E and spoken to in such a manner that any healthcare professional found to be conducting themselves like this should be investigated and disciplined. Yet they are not, despite so much evidence in the public arena. Why are you seemingly supporting the actions of these health care professionals by omission of action, by your silent acquiescence?
Do you condone the behaviour of the nurses on your register that are bullying and coercing patients into wearing masks and to take the test?
What has happened to informed consent?
Where is the informed consent for masks?
Mask do not work and are potentially harmful. You should know this. Yet you remain silent and allow the people of this country to have this imposed on them despite the absence of any scientific supporting evidence. You remain silent while masks are imposed on children. Surely you have considered the devastating effect this will and has already had on their mental health and consequently their physical health?
The shaming of people who are mask exempt is actively encouraged.
Many of those that are mask exempt are too afraid to leave their homes for fear of the judgement and abuse they may receive. As a nurse I have been told by too many mask exempt patients of the distress they have suffered at the hands of others, healthcare professionals included. They have been bullied, shamed and coerced into feeling they must wear a mask even if this would be detrimental to them. Emotionally blackmailed, ” Wearing is Caring”. Disgraceful marketing campaigns displayed everywhere insisting that masks must be worn otherwise entry/service will be denied. Yet these masks are useless.
Bullies in all types of establishments, once again, healthcare settings included, insisting on proof/ disclosure of exemption and denial of the existence or validity of the ‘Equality Act 2010’. There are people that are simply not mentally robust enough to withstand the
discrimination, judgements and verbal assaults, so they either stay home ( meaning further social isolation/exclusion) or succumb to the bullying and wear masks despite it causing them physical or mental distress/ harm. This is totally unacceptable. Yet you remain silent.
Where is the informed consent for tests?
The tests are unforgivably inaccurate. The PCR test was never designed as a diagnostic tool, clearly stated by its inventor Kary Mullis. Surely you are aware of this too? If not why not? It is your responsibility to be aware of the facts. And if you are aware why are you silent? Why are you not challenging the Government policy in order to protect and do no harm?
These inaccurate tests have been used to justify injustices on the people on a scale that is nothing short of criminal.
They have been used to fabricate a health threat and bring this country to its knees through fear.
These tests have been used to label healthy, asymptomatic individuals as a potential threat to the lives of others and to facilitate world governments in rolling out Draconian measures/restrictions on their people, the people they were elected to serve.
So-called asymptomatic cases have never in the history of respiratory disease been the driver for the spread of infection. Rather it is symptomatic people who spread respiratory infections – not asymptomatic people.
Why have you not challenged this?
The measures imposed on us all are responsible for the destruction of lives, livelihoods, mental health and the very essence of what makes us human, our connections to one another, making people, and sickeningly, children, fearful of each other. Dehumanisation.
It has all been ‘marketed’ as protecting the vulnerable.
What about all the other vulnerable members of our society? I am sure I don’t need to list them.
Are their needs no longer important?
The fact that Healthcare professionals across the UK are refusing patients treatment and investigations if they are mask exempt and if they refuse a test and/or being told that they will be removed from treatment and investigation lists if they refuse the test is unethical medical tyranny.
I have personally been party in my professional capacity to my colleagues proudly stating how they have informed patients that if they refuse a test they will be removed from the waiting list. I asked a senior colleague to show me where in the admission process we asked patients for their informed consent for mask wearing. I was told, that patients are
told they must wear a mask and they know if they do not then they will not be admitted to the hospital and therefore they will not get treatment, so they wear a mask. I witnessed all surgical patients being expected to wear surgical masks post surgery and even some Consultant Anaesthetists insisting patients requiring oxygen therapy must wear surgical masks beneath their oxygen delivery masks, without any evidence of efficacy or potential harm this may cause. I saw my own colleagues enforcing this, without any evidence to back up this new practice.
Do you condone this?
Again, if you do not then why are you silent?
Where is the informed consent for the experimental vaccines?
Do you have the supporting evidence that the vaccines are safe and do not cause harm?
In the absence of this evidence why are you not challenging Government roll out of the vaccine?
Why are you not speaking out about the Government proposals to make it a requirement for healthcare professionals to have the vaccine ? Surely consultation is necessary? Why are you not in consultation with the Government on this matter?
I called your helpline and was told that you were not in consultation and would simply follow the guidance of the Government.
Why are you not advocating for your members and the people of the UK?
Are you aware of the many devastating adverse reactions that are being experienced by people who are having this experimental vaccine? Are you aware of the deaths caused by this experimental vaccine?
Why have you not challenged this?
To be a healthcare professional who asks questions now is to be labelled ‘uncaring’ a ‘firebrand’ or a ‘conspiracy theorist’.
This is wrong, we have a duty to question.
We have a duty to be informed, to inform and to provide care that does no harm and is consented to via informed consent.
I assume you agree.
Yet part of our training on radicalisation now includes those people who question the official government narrative on ‘Covid 19’ as having been potentially radicalised into extreme views.
This is wrong. Do you support this?
Are your members that are in support of the vaccine roll out and are administering these vaccines fully aware of all the facts of each vaccine?
Are they providing patients with all these facts? If not why not?
I would suggest that this is in the very least negligence by any party to be not appropriately informed and to not appropriately inform.
Are you aware that Dr Reiner Fuellmich has initiated legal proceedings against the CDC, WHO and the Davos Group for crimes against humanity and violations of the Nuremburg Code?
“Fuellmich and his team present the incorrect PCR test and the order for doctors to describe any comorbidity death as a Covid death – as fraud.
In addition to the incorrect tests and fraudulent death certificates, the “experimental” vaccine itself violates Article 32 of the Geneva Convention…
Under Article 32 of the 1949 Geneva Convention, “mutilation and medical or scientific experiments not required for the medical treatment of a protected person” are prohibited.
According to Article 147, conducting biological experiments on protected persons is a serious breach of the Convention.
The “experimental” vaccine violates all 10 Nuremberg codes – which carry the death penalty for those who try to break these international laws”.
Soren Dreier 09.05.2021
You will of course be aware that a ‘Covid’ death, is a death from any cause within 28 days of a positive test.
A test that is inaccurate and deaths whose primary (actual) cause could have been anything, yet the people of the UK have had their businesses, lives and health destroyed based on these figures.
And still you remain silent.
Below is an article written by Dr Mike Yeadon May 10, 2021
Why are we being lied to about Covid? There’s no good reason
BE in no doubt, among the reasons that voices and opinions like mine are never heard in the main media is extreme censorship more suited to China than a liberal democracy. Please allow me to illustrate with an example close to my heart why it is high time for us to change our response.
Ivermectin is one of the WHO’s ‘essential drugs’ which all countries should have access to. It’s very cheap as its patent has long expired; it’s one of the most-used drugs in world history; it’s extraordinarily safe; it is often life-saving against parasitic infections. It is also one of the best-established pharmaceutical treatments for Covid-19, showing benefit in every stage of the disease, in multiple independent clinical trials of varying quality. On January 3, 2021, Dr Tess Lawrie attempted to alert the Prime Minister to the potential of Ivermectin. Her video was pulled from YouTube within hours of posting, though it survives on Vimeo. The paper by the FLCCC group of US intensivists (whose survival rates for severe Covid-19 are best in class) that was the inspiration for Dr Lawrie’s work was accepted after extensive open peer review (including two career employees of the FDA) and ‘provisionally accepted’ by the ‘open science’ journal Frontiers in Pharmacology. The screenshot of the abstract tweeted by Clare Craig attracted more than 100,000 views. Then, mysteriously, it was rejected and pulled by the Frontiers editor in chief. It is still in cached form though the Ministry of Truth has been at work and placed it in a memory hole, so no trace survives on Frontiers’ own website.
Intended for a Special Issue on ‘repurposed drugs’ for Covid-19, various guest editors were so incensed at this behaviour that they resigned in protest. They concluded that ‘these unfortunate events constitute gross editorial misconduct by Frontiers.’ Fortunately this major paper is now published by the American Journal of Therapeutics and can be read below.
This nevertheless successfully delayed by nearly six months its circulation to leading public health bodies starting mid-November. A copy was sent to Sir Jeremy Farrar (boss of the Wellcome Trust and member of Sage) who passed it on to Professor Peter Horby (also on Sage), amongst others, on November 18, 2020. So the efficacy of Ivermectin must be well known to the Government’s advisers, but they have done nothing about it. Likewise, the formal and rigorous meta-analysis performed by Dr Tess Lawrie’s team at the Evidence-Based Medicine Consultancy Ltd has been communicated to Matt Hancock, but without reply.
I am telling you about this, because all that governments, their scientific advisers, big Pharma and regulatory agencies will tell you is that Ivermectin doesn’t work in Covid-19. They are lying. I am inviting any of them to sue me, but they won’t, for I would win easily.
If Ivermectin was more widely used, there’d be no need for vaccines.
To date, despite the brains, expertise and stature of those scientists questioning the official Covid-19 narrative, as a group they have quite patently been ineffective. And this is unlikely to change while, as polite professionals, they won’t say: ‘This is corruption and they’re lying deliberately to scare the people.’ Furthermore, unwittingly, they have been playing the parts intended by those, including our own Government and their advisers, who control the global Covid narrative.
They judged correctly that we polite Brits wouldn’t accuse them of outright lying, even though they often do exactly that. Boris Johnson’s recent piece to camera, telling us that it was lockdown and not vaccination which reduced cases and deaths, is a case in point. Yet it’s certain this isn’t true, and also certain he and his advisers know it isn’t true.
The government’s advisers are not fools. Some may be, but the upper echelons are very smart. They believe polite people won’t say ‘not only are you lying but you’re doing it in concert with other, non-democratic actors’, because that’s conspiracy theory stuff, right? Powerful people never use their influence to benefit their interests, do they? Hmm. The only thing that’s different is scale and the power their public positions give them. Other than that, they’re just another a bunch of grubby criminals, ripping off unsuspecting people.
Truth is our most powerful tool. And that truth is that we’re being lied to.
The truth also, however hard it is to believe it, is that there is unequivocal and clear evidence of planning and co-ordination. Not to face this fact is to have your head in the sand. Where it’s leading is easy to discern, once people are willing to lift their internal censoring and look objectively at the evidence.
First, though, the lies. It’s abundantly clear now that pretty much everything that the public has been told and continues to be told is between untrue and downright lies.
I offer as a shortlist that:
-PCR mass testing reasonably reliably distinguishes infected and infectious people from others;
-that masks reduce transmission of respiratory viruses;
-that transmission of infection in the absence of symptoms is an important contribution to epidemic spreading;
-that lockdowns as executed reduce hospitalisation and deaths;
-that no matter how small the remaining susceptible population and no matter that virtually no people who, if infected, might die remain unvaccinated, the position is perilous;
-that no pharmaceutical treatments are available;
-that variants are different enough to warrant border closures and require new vaccines; -that the gene-based vaccines are safe and effective;
-that ‘vaccine passports’ will increase safety while having no material impacts on freedom of choice in a liberal democracy.
It is impossible to believe that intelligent, well-connected and well-briefed senior advisers to governments don’t know that almost all, if not all, of the above are simply not true.
It is not a matter of opinion in almost all cases. These statements, which have been explicitly stated and used in justification for the extraordinary interferences in the lives of citizens in democratic countries, are mostly demonstrably wrong, as defined by there being multiple well-conducted, peer-reviewed studies showing the contrary.
To continue with the pretence that there’s scientific uncertainty, and it is therefore understandable that an adviser might offer nuanced advice, is wrong and misleading. This perhaps is where the mainstream media has been most culpable.
It is not reasonable to expect typical viewers and readers of speeches, articles and editorials – whether by scientist sceptics or by critical commentators – to appreciate that, when we point out that what’s happening doesn’t make sense, we mean ‘the executive is knowingly and deliberately harming the country and its citizens’. We are mostly not saying this, leaving it to the audience to sum up for themselves. But in my view the audience are
reluctant to do this. They want to believe in government and perhaps above all they want a quiet life. To disbelieve is so much harder than to believe.
So in recent weeks I’ve made a clear decision no longer merely to point out what it is that governments and their advisers and spokespersons around the world are doing is wrong, scientifically unjustified and harmful, but to join the dots in an attempt to provide potential explanations of why they’re doing these things.
It is time for all Doubting Thomases to take a lead and state unambiguously that ‘government and its advisers are telling us things that are manifestly untrue and maintaining restrictive, damaging measures for which there’s no justification’. By not doing so they are playing into the hands of those who I firmly believe are engaged in a determined series of crimes against humanity.
Why do I say this? Simply because there is no benign interpretation of the acts of commission and omission consistently imposed upon us and no explanation of the statements which are flatly wrong other than an intention to deceive the population.
Looking around us now, we see that the prevalence of the virus in the community is effectively zero. Note that the authorities have never conceded and determined the operational false positive rate of PCR mass testing. Subtracting any reasonable estimate of oFPR and we observe no cases at all. This was true for months as indicated by the positive rate in lateral flow tests.
No variant of the virus differs by more than 0.3 per cent from the original sequence, and numerous academic immunologists have stated strongly that there is no possibility that booster/top-up/variant vaccines are required. Yet we get daily ‘fear porn’ on this topic. The European Parliament just voted through the basic outlines of a vaccine passport system. It’s a racing certainty that the UK will soon follow.
Mask regulations continue in force and many psychologists believe some people are so traumatised that they will continue to wear them indefinitely, even though they are useless.
The economy and currency may already be damaged beyond repair. Yet there’s another six weeks minimum until the last restrictions are scheduled to be lifted.
Almost no one is dying ‘with’ Covid-19 now, and the attribution methodology overestimates this anyway. Yet hospitals and primary health care remain far less accessible than they should be, inevitably resulting in causing or storing up avoidable non-Covid-19 deaths, to say nothing of the suffering and misery of the millions awaiting treatments for painful and worrying illnesses.
Most terrifyingly, it appears we will soon be required to possess VaxPass apps if we wish to continue to access our lives.
This system can run effectively only if everyone is vaccinated. This is a monstrous concept, because it is known that all four vaccines in use in Europe contain a fatal design flaw: they cause the fusogenic, pro coagulation spike protein to be expressed wherever the vaccine is taken up. In some people, especially those so young that they’re at no measurable risk of death if infected by the virus, vaccination results in their deaths from thromboembolic events. Permitting the inexpert population to walk into this trap is
unconscionable: there will be thousands of further vaccine-induced deaths of young people.
I invite thoughtful people to ask that difficult question: ‘Why are they doing this?’
It is my deduction and conclusion that the only motivation that fits all the observations is the intention to ‘herd’ every citizen into a VaxPass system. This is a completely novel system. Never before have all individuals been represented in a single, interoperable database as a unique digital ID, accompanied by an editable health-related field. Whoever controls that database, and the algorithms which govern what it permits and denies, has literally totalitarian control of the entire population. There is no personal threshold crossing or transaction which doesn’t fall to those operating that system.
At the very least, the public deserves to be warned that this is coming. I do not expect conventional judicial processes to protect us in any way. Every institution has already failed the people of the UK.
Given that numerous government decisions (as instructed by Sage) have arguably already led to many avoidable deaths, I think it’s only reasonable to consider what the prize is that leads intelligent people to do the things they’ve done and continue to peddle.
The possible answers to this question are all bad. I cannot conceive of a situation where we will shortly be permitted to resume our normal lives. There is not the slightest hint of that in any case.
I have found it impossible to come up with a benign interpretation of the events. No one works as carefully and for so long as evidently has been done, across the world, only suddenly to stop. Why?I’ve asked hundreds of people and not a single one has (a) pointed out where my logic fails or (b) come up with a benign interpretation.
My own conviction is that the purpose is, at minimum, to establish a system of totalitarian control which will mean the extinguishing of liberal democracy.
It almost doesn’t matter what the next steps might be, but they could, for example, have been sold to numerous people as the only solution to ‘anthropogenic global warming’: the amount of resources we’ll be permitted to produce and consume will be set by some unseen controllers. It is possible they could go a step further than this, and see reducing population or depopulation as another route to solving the perceived problem of AGW.
Consider the elimination of the class of the inquiring journalist, the censorship of all mass media. The relentless smearing and exclusion of those who ask too many awkward questions. The astonishing waste of public money, which apparently the foreign exchange markets are unperturbed about. The destruction of SMEs which provide a third of all jobs and a substantial proportion of tax revenues. The relentless lying. The misinformation. The use of psychological operations to frighten and subdue. The utter disregard for those vaccinated with ‘vaccines’ that are way too unsafe for their role. The bending past illegality of the use of incorrect information to persuade pregnant women to get vaccinated. The numerous breaches of the Nuremberg Code, since no one is being explicitly told that these vaccines are experimental and so recipients are being unwittingly enrolled in an unprecedentedly large and unmonitored Phase 3 clinical trial. The announcement that, soon, our minor children are to be vaccinated.
Add in the ‘top-up vaccines’. They’re not vaccines. Whoever has been vaccinated has no need of further vaccination. Immunology is perhaps my strongest suit, so I am certain of this. Is it impossible that in those one billion vials which has already told us its manufacturing, there is some gene sequence which will instigate one of a few dozen pathologies, with onset times ranging from near-immediate to a short number of years? I assure you, biotechnology has awesome power, and it can be used for good or ill.
I think I’ve made a decent case that what governments and their advisers have done easily amounts to conspiracy. The same ‘mistakes’ have been made everywhere. The same tricks and manipulation. Those who claim this is all coincidence are coincidence theorists.
I argue that unless this is pointed out to the public before any possible ‘vaccine passports’ system is established, we’ve all collectively failed to discharge our duties to be courageous, to take chances, to risk looking foolish: I am absolutely committed to continuing to speak out for as long as I have breath in my body”.
https://mobile.twitter.com/ClareCraigPath/status/1366680939368243203
https://web.archive.org/web/20210225073859/https://www.frontiersin.org/articles/ 10.3389/fphar.2021.643369/abstract
https://journals.lww.com/americantherapeutics/Fulltext/2021/06000/ Review_of_the_Emerging_Evidence_Demonstrating_the.4.aspx
“Dr Mike Yeadon has a degree in biochemistry and toxicology and a research-based PhD in respiratory pharmacology. He has spent over 30 years leading new medicines research in some of the world’s largest pharmaceutical companies, leaving Pfizer in 2011 as Vice President & Chief Scientist for Allergy & Respiratory. That was the most senior research position in this field in Pfizer. Since leaving Pfizer, Dr Yeadon has founded his own biotech company,
Ziarco, which was sold to the worlds biggest drug company, Novartis, in 2017”
I ask you, are you aware of Ivermectin and the work of Dr Tess Lawrie? If not why not?
Why are you not pressuring the Government to at the very least consider this?
Why are you not questioning government policy and demanding their evidence to support their policies?
Instead through your silence you have and continue to allow them to aggressively enforce, social distancing, social isolation, closure of businesses and places of spiritual practice, ineffective and harmful masks, hand sanitiser and the roll out on an uninformed public of experimental vaccines?
They trust us and you are failing them through your silence and unquestioning complicity.
Dr Mike Yeadon and Dr Tess Lawrie are not alone in questioning what is happening yet all and anyone that does question are aggressively censored. Their work removed and labelled dangerous misinformation. All debate and reasonable discussion immediately quashed.
Do you not stop to wonder why? You should. You have a moral and professional responsibility to do so.
In my opinion anyone now that knows that something is very wrong with what we are being told, even merely suspects something is very wrong and does nothing, remains silent, condoning these injustices and encourages the vilification or actively vilifies or attempts to silence those speaking for truth and justice is morally bankrupt. So, do what you will or won’t with this letter but now you are in possession of it and if you choose to ignore the issues presented then you can no longer claim nescience but are being wilfully ignorant.
It is with immense sadness that I end my nursing career but I will not be a part of these crimes against humanity and against the patients I/we should be protecting and I do not consent or wish to be governed by a body that silently complies with Government tyranny and bases their judgement as to whether I am fit to practice as a nurse on my levels of compliance or in my case non- compliance with tyranny.
I echo Dr Mike Yeadon in saying I will fight for truth, freedom, medical freedom and the health, rights and freedoms of others so long as I have breath in my body.
Yours sincerely
(Sent by email)
Emma
It is easy to see this is the commoditisation of human immune systems by Big Pharma and Fauci.
It is less easy to see this is the same business model as conveniently occurring computer viruses leading to universal antivirus software. Although the involvement of Bill Gates pushing vaccines helps in that regard.
It is not so hard to see that the man made virus and big tech vaccines will lead to a big tech managed and big tech enforced social credit score vaccine Passport system, which will exclude anybody who has not been sufficiently jabbed (how ever many times it may be by then). Paypal is already working on a no buy list by teaming up with silicon valley wokenuts
It is easy to see by faith that the vaccine passports will be the mark of the beast upon the right hand (controlling your actions) and the social credit scores will be the Mark of the beast of Revelation13 upon the forehead (controlling your thoughts).
It is extremely difficult to see that the vaccines are the snake bite of Genesis 3:15, a fang for a vaccination. And that they are the means by which the demons are genetically appropriating mankind in order to enslave them and thereby deny them salvation. But when you do the maths there are 48 trillion copies of spike protein mRNA weighing 100 micrograms in Moderna and 14.4 Trillion copies weighing 30 micrograms in Pfizer in circumstances where you have 30-37 Trillion cells. The ones that count here are the brain cells which are not replaced. The seed of the serpent of Genesis 3:15 was Cain. Cain means spike or needle or spear in Hebrew. So it applies equally well to spike proteins and vaccinations
So in conclusion, the vaccines are the means by which the demons recruit mankind to their side, genetically, economically, socially and politically in advance of the final battle of Armageddon.
The book of Daniel says: No wicked shall understand. The gospels say 50% of 50%
will not be saved (2 women at mill 1 taken, 2 men in one bed 1 taken of Luke17,
2 women at mill 1 taken, 2 men in field 1 taken of Matthew24) So 75% of us will see through this at some point.
The data from Israel on 2021August14 were as follows (tabulated from https://datadashboard.health.gov.il/COVID-19/general ...
The Graphic does not work correctly. It's the absolute number of active cases (not per 100k - click the down arrow to the left of the 'At a rate per 100k' legend on the Ministry of Health site). So double vaccination is providing a big benefit to 12-20 year olds, a small benefit to 20-40 year olds and little to non benefit to 40-80 year olds. This is because the longer you have the vaccine the less benefit it gives you. Booster jabs (Dose 3 in turquoise) are shown to have no positive effect at all - or possibly a negative effect..
Actually I suspect that 0.1% of ONE JAB would be a really really efficacious and pretty safe doseage. It would produce the death rates of a normal vaccine.
The amount of SARS-CoV-2 virus that needs to be present in the body to trigger the infection is unclear [Why?]. Other respiratory viruses could offer insight into this number. For example, SARS, another coronavirus, requires just a few hundred viral particles for an infective dose, while the dose for MERS is several thousands of particles. - https://www.ashclinicalnews.org/online-exclusives/much-coronavirus-must-present-get-sick/
To estimate probability that a droplet would contain at least one virus particle, Basu used a study on the amount of virus in the sputum and mucus of COVID-19 patients and accounted for dehydration. He conservatively estimated about 300 virus particles as the threshold for infection. Typically, an inhaled viral infection requires 1,950 to 3,000 virus particles.
"The fact that the number of virus particles needed to launch the infection is in the range of hundreds is very remarkable, and shows how contagious this particular virus is," Basu said.
- https://www.webmd.com/lung/news/20201105/dose-of-coronavirus-timing-matters-for-infection#1
Fatal respiratory failure due to lung damage in coronavirus infection is attributed to rapid virus replication and excessive immune responses. The coronaviruses could reach titers as high as 108–1010 copies/ml in the upper respiratory tract of patients
The virus replication time scale within pulmonary cells is estimated to about 6 hours - https://www.biorxiv.org/content/10.1101/2021.08.02.454730v1.full.pdf
Quantitatively describing the time course of the SARS-CoV-2 infection within an infected individual is important for understanding the current global pandemic and possible ways to combat it. Here we integrate the best current knowledge about the typical viral load of SARS-CoV-2 in bodily fluids and host tissues to estimate the total number and mass of SARS-CoV-2 virions in an infected person (A virion is a complete extracellular virus particle, the unit which is able to spread the virus to another cell - I would call that the virus, or a virus particle myself). We estimate that each infected person carries 109–1011 virions (each containing one copy of the viral RNA) during peak infection, with a total mass in the range of 1–100 μg, which curiously implies that all SARS-CoV-2 virions currently circulating within ALL human hosts have a collective mass of only 0.1–10 kg (100 million human hosts). We combine our estimates with the available literature on host immune response and viral mutation rates to demonstrate how antibodies markedly outnumber the spike proteins and the genetic diversity of virions in an infected host covers all possible single nucleotide substitutions - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7685332/
So a fully infected person has 109–1011 (1 billion to 100 billion) copies of viral RNA in his body. So 10 billion copies would be enough for a vaccine. But the vaccines have 14.4 Trillion (Pfizer) and 48Trillion (Moderna). So these concoctions are not vaccines, but are body wide gene therapy (the body has 30-37 trillion cells - https://en.wikipedia.org/wiki/Human_body). An infectious unit is a TCID50, which is a sufficient number of virions to kill 50% of a standardised cell culture.
Add to this the possibility that both COVID-19 and the mrNA spike proteins can be reverse transcribed into human DNA and you have the fulfilment of Genesis 3:15, mankind being genetically modified to be Cainian rather than adamic.
https://www.pnas.org/content/118/21/e2105968118
https://www.biorxiv.org/content/10.1101/2020.12.12.422516v1.full.pdf
Retroviruses, Metaviruses, Pseudoviruses, Hepadnaviruses and Caulimoviruses can reverse transcribe their viral RNA into Human DNA
https://pubmed.ncbi.nlm.nih.gov/28043823/
https://talk.ictvonline.org/ictv-reports/ictv_9th_report/reverse-transcribing-dna-and-rna-viruses-2011/w/rt_viruses/159/pseudoviridae
So mankind could have used any of these to add reverse transcription as a gain of function property to COVID-19
https://24hoursworld.com/oxford-study-vaccinated-with-delta-similarly-contagious-as-unvaccinated/
Two vaccinations with Biontech / Pfizer or AstraZeneca offer good protection against the highly contagious Delta-Corona variant. But the effectiveness decreases over time – and an infection with the Delta variant triggers a viral load similar to that of non-vaccinated people in fully vaccinated people, scientists from the University of Oxford found in a study published on Thursday. If they become infected, people who have been vaccinated may be as contagious as those who have not been vaccinated.
For the study, which has not yet been peer-reviewed, the researchers analyzed results from more than three million adult nasal and throat swabs in the UK. To compare the time periods before and after Delta spread, the researchers analyzed about 2.58 million smears from around 380,000 adults between early December and mid-May, and 810,000 test results from 360,000 participants between mid-May and early August.
They also found that protection from infection 90 days after the second vaccination was 75 percent with Biontech / Pfizer and 61 percent with AstraZeneca. Two weeks after the second dose, this was still 85 percent and 68 percent, respectively. “These data tell us nothing about the level of protection against serious illnesses and hospitalization, two very important factors when looking at the effectiveness of the vaccines,” said Pouwels.
The researchers did not predict how much protection might decrease over time, but suggested that the effectiveness of both vaccines should be similar four to five months after the second vaccination.
Translating the above. 3 months after the 2nd Jab, all 3 major vaccines do nothing to reduce viral load. That means they will do nothing to prevent transmission. The trouble is that we are now 4-6 months after the 2nd jab for a lot of people. The continuous degradation momentum will mean that for them the vaccines INCREASE viral load when compared to unvaccinated people. The researchers did not 'predict how much protection might decrease over time'
because it had already evaporated by month 3 and would go negative in month 4.
A father and daughter duo in Texas last month demonstrated to a school board how masks produce bad air quality not suitable for breathing.
The incident happened on August 24 at a school board in Lago Vista, outside of Austin.
During the demonstration, the father who works in construction brings his daughter and an air quality monitor device up to the front of the board meeting.
The dad says he uses the device at his job to make sure air levels aren’t hazardous and are suitable for working conditions.
“Before you get into that hole you drop this device down that hole, if it alarms ‘not safe’ you cannot go into that spot; if it doesn’t you’re good to go,” the dad explains.
“Once you’re in there every single employee that’s in there has to wear this device and if it ever goes off for any reason everybody immediately drops all their tools whatever they’re doing – they get out.”
He then proceeds to use it to measure his unmasked daughter’s oxygen levels, which are normal.
He then tests it with her wearing a mask, and immediately the monitor begins to beep.
- https://www.infowars.com/posts/watch-dad-and-daughter-demonstrate-masks-produce-hazardous-air-quality/
A new study (still in pre print form - https://www.medrxiv.org/content/10.1101/2021.08.24.21262415v1) conducted in Israel, one of the most highly COVID-19 vaccinated countries in the world, examined the medical records of tens of thousands of Israelis between the first of June and the 14th of August.
During this time the Delta variant was the predominant strain infecting people in Israel. The researchers looked at infections, symptoms, and hospitalizations, and is to date the largest real-world observational study to compare natural versus vaccine-induced immunity to SARS-CoV-2.
Researchers used the database of Maccabi Healthcare Services. In two analyses they found that people who have never been infected before, but who were vaccinated, were six to thirteen times more likely to get infected than unvaccinated people who were previously infected.
In one analysis that compared more than 32,000 people, they found that the risk of developing symptomatic COVID-19 was 27 times higher among the vaccinated, and the risk of hospitalization 8 times higher - https://thepulse.one/2021/08/29/covid-infection-provides-greater-protection-than-being-fully-vaccinated-new-study/
https://rumble.com/vftpdz-dr.-harvey-risch-60-of-new-covid-patients-have-been-vaccinated.html
Lets do some maths on those figures. We can deduce from these how effective Pfizer is.
4/5 of the people (vaccinated) produced 3/5 of the cases and 1/5 of the people (unvaccinated) produced 2/5 of the cases. So vaccinated people are 3/4 x 1/2 = 3/8 as likely to be hospitalised as unvaccinated. So the vaccine reduces infections by 5/8 or 62.5% NOT 95% as Pfizer claim. That is real world data. But boosted Vitamin D reduces the chance of being hospitalized in Intensive care by 80% and reduces COVID morlality by 60%.
"The research, published by the Social Science Research Network, found Covid-19 patients given doses of Vitamin D were 80 per cent less likely to require ICU treatment. Those from the University of Barcelona also concluded that 'adjusted results showed a reduced mortality of more than 60 per cent' for those who were given the calcifediol treatment." - https://www.dailymail.co.uk/news/article-9257521/Study-finds-Vitamin-D-reduces-Covid-deaths-60.html
So Vitamin D offered better protection than Pfizer in 2021April
Israel Confirmed Cases 2021July4 to 2021July31
Age Group | Fully Vaccinated Cases | Unvaccinated Cases | Fully Vaccinated Cases % | Fully Vaccinated Population % |
20-29 | 2688 | 795 | 77.2 | 71.9 |
30-39 | 3176 | 881 | 78.3 | 77.4 |
40-49 | 3303 | 635 | 83.9 | 60.9 |
50-59 | 2200 | 359 | 86.0 | 84.4 |
60-69 | 2200 | 187 | 92.2 | 86.9 |
70-79 | 1384 | 100 | 93.3 | 92.9 |
80-89 | 540 | 61 | 88.9 | 91.2 |
90+ | 142 | 20 | 87.7 | 88.7 |
29-90+ | 15634 | 3038 | 86.0 | 84.4 |
So in the 3 months from from April to July we see the degradation in performance of the vaccines (Pfizer only) from better than unvaccinated to worse than unvaccinated. They had to go for the 3rd shot to cover up further degradation.
https://www.infowars.com/posts/ultra-vaxxed-israel-now-has-highest-cv-case-rate-in-the-world-sweden-bans-travelers-from-israel/
https://www.youtube.com/watch?v=N1LAyEO1zGI
https://www.youtube.com/watch?v=SZ8SfvgILgQ
Doubly vaccinated people over 50 at the end of August were 24.4% MORE likely to catch delta than unvaccinated people according to PHEs latest genetical sequenced delta numbers..
PHE are one of the few govt agencies in the world which produce decent figures for delta cases at least. This is not vaccines losing efficacy. It is vaccines degrading your immune system, progressively month on month. Vaccines have gone negative as regards transmission. That cannot be a loss of efficacy..
Since it is known (if you do the maths) that vaccines degrade the immune system to the point where one is 24.4% more susceptible to infection, 6 months after the 2nd jab - What will they do to children after 5 years?
6 months ago they absolutely reduced transmission by at least 75% Now they increase it by 24.4%. There is no risk benefit analysis to be done. It is a risk damage analysis. All the govt scientists have access to these figures.
Here again is the maths.
PHE figures for over 50s with genetically sequenced delta.
0Jabs and 1Jab and 2Jabs
6724 and 6899 and 51420 (Technical briefing 22 up to August29)
4891 and 6303 and 32828 (Technical briefing 21 up to August15)
1833 and 596 and 18592 (TB22-TB21 for the period from August16-29)
8.7% and 2.8% and 88.5% of cases out of 21021 (TB22-TB21 for the period from August16-29)
9.7% and 11.0% and 79.3% of people over 50 have respectively 0 and 1 and 2 jabs (5.15m and 5.80m and 41.94m out of 52.89m Adult population on August 23 - assuming over 20s have now had enough time to catch up over 50s in jabs if they wished to do so)
The UK Dept of Health and Social Care study shows that 82% of new cases are fully vaccinated
PHE latest figures show that 88.5% of new delta cases in over 50s occur in fully vaccinated people, But only 79.3% of over 50s were fully vaccinated at that time. .
The CDC Barnstable study showed that being doubly vaccinated made it more likely to catch delta.
The Oxford University Vietnam study shows that doubly vaccinated people with delta have 251x the viral load of unvaccinated people with alpha.
Fauci said last month that the viral load in the vaccinated is no different to the viral load in the unvaccinated.
The purpose of a vaccine is to reduce transmission, infectivity, viral load and help achieve herd immunity. The vaccines no longer do any of those things for delta.
They worked for a while against alpha. They have now failed against delta in every respect. Worse than that they are actually making people more likely to be infected, which means they are damaging our immune systems with their incessant spike production.
They offer no help to children or adults other than a short term increase in immunity for a few months followed by a slow decline thereafter with a tipping point going negative around 6 months after the 2nd jab. This is now known. The JCVI did not make their recommendation lightly.
The figures show that these vaccines progressively damage the immune system. This has only been confirmed in the last month or so. I do not know what words to use to persuade people not to ruin their immune systems or their children's immune systems other than to point out that 40 million people have died of AIDS and that there are 20 million AIDS orphans in the world. AIDS stands for Acquired Immune Deficiency Syndrome. What these vaccines do is progressively make your immune system more and more deficient. This is hardly surprising since the COVID19 spike proteins contain the furin cleavage site from HIV1.
We studied breakthrough infections among healthcare workers of a major infectious diseases hospital in Vietnam. We collected demographics, vaccination history and results of PCR diagnosis alongside clinical data. We measured SARS-CoV-2 (neutralizing) antibodies at diagnosis, and at week 1, 2 and 3 after diagnosis. We sequenced the viruses using ARTIC protocol. Findings: Between 11th–25th June 2021 (week 7–8 after dose 2), 69 healthcare workers were tested positive for SARS-CoV-2. 62 participated in the clinical study. 49 were (pre)symptomatic with one requiring oxygen supplementation. All recovered uneventfully. 23 complete-genome sequences were obtained. They all belonged to the Delta variant, and were phylogenetically distinct from the contemporary Delta variant sequences obtained from community transmission cases, suggestive of ongoing transmission between the workers. Viral loads of breakthrough Delta variant infection cases were 251 times higher than those of cases infected with old strains detected between March-April 2020. Time from diagnosis to PCR negative was 8–33 days (median: 21). Neutralizing antibody levels after vaccination and at diagnosis of the cases were lower than those in the matched uninfected controls. There was no correlation between vaccine-induced neutralizing antibody levels and viral loads or the development of symptoms. - https://papers.ssrn.com/sol3/papers.cfm?abstract_id=3897733
This is clearly saying the vaccine had zero effect on delta. Vaccines produce antibodies. But there was no correlation between the levels of said antibodies and viral load or symptom progression. The study plainly shows that Astra Zeneca (the vaccine used in Vietnam) has zero effect on Delta. DOH!
But Pfizer and Moderna contain the same spike protein and so will cause your immune system to produce the same antibodies. So no vaccine has any effect on Delta. In fact Prof Montagnier said that the vaccines will produce variants which can evade them. The Vietnam study shows that Delta is such a variant.
Dr Ryan Cole was trained at the Mayo Clinic and runs the largest Independent testing lab in Idaho - USA. He has discovered that the vaccines cause a form of immune deficiency, a new type of AIDS (Acquired Immune Deficiency Syndrome).
HIV reduces the numbers of your CD4 helper T Cells. These vaccines reduce the number of your CD8 killer T cells.
He is seeing 20x the normal number of Cancers and elevated rates of many types of virus infections including Herpes and HPV in vaccinated people.
https://twitter.com/i/status/1430589141344034816
https://covid19criticalcare.com/ or www.flccc.net
Here is the entire protein sequence of Wuhan Hu1 - From https://www.ncbi.nlm.nih.gov/nuccore/NC_045512
ORF1ab polyprotein
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
CSCDQLREPMLQSADAQSFLNRVCGVSAARLTPCGTGTSTDVVYRAFDIYNDKVAGFAKF
LKTNCCRFQEKDEDDNLIDSYFVVKRHTFSNYQHEETIYNLLKDCPAVAKHDFFKFRIDG
DMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVEN
PDILRVYANLGERVRQALLKTVQFCDAMRNAGIVGVLTLDNQDLNGNWYDFGDFIQTTPG
SGVPVVDSYYSLLMPILTLTRALTAESHVDTDLTKPYIKWDLLKYDFTEERLKLFDRYFK
YWDQTYHPNCVNCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHF
RELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQ
TVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQ
LLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALF
AYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVV
IGTSKFYGGWHNMLKTVYSDVENPHLMGWDYPKCDRAMPNMLRIMASLVLARKHTTCCSL
SHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALL
STDGNKIADKYVRNLQHRLYECLYRNRDVDTDFVNEFYAYLRKHFSMMILSDDAVVCFNS
TYASQGLVASIKNFKSVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVY
LPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYI
RKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRC
GACIRRPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHK
PPISFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAE
TLKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQIG
EYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTL
NISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDA
LCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEI
SMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDM
FLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVV
REFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSC
NVNRFNVAITRAKVGILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKVI
TGLHPTQAPTHLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFIT
REEAIRHVRAWIGFDVEGCHATREAVGTNLPLQLGFSTGVNLVAVPTGYVDTPNNTDFSR
VSAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKNLSDRVVFVLWAHGFELTSM
KYFVKIGPERTCCLCDRRATCFSTASDTYACWHHSIGFDYVYNPFMIDVQQWGFTGNLQS
NHDLYCQVHGNAHVASCDAIMTRCLAVHECFVKRVDWTIEYPIIGDELKINAACRKVQHM
VVKAALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDAQPCSDKAYKIEELFYSYATHSD
KFTDGVCLFWNCNVDRYPANSIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKSA
FVNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYRLYL
DAYNMMISAGFSLWVYKQFDTYNLWNTFTRLQSLENVAFNVVNKGHFDGQQGEVPVSIIN
NTVYTKVDGVDVELFENKTTLPVNVAFELWAKRNIKPVPEVKILNNLGVDIAANTVIWDY
KRDAPAHISTIGVCSMTDIAKKPTETICAPLTVFFDGRVDGQVDLFRNARNGVLITEGSV
KGLQPSVGPKQASLNGVTLIGEAVKTQFNYYKKVDGVVQQLPETYFTQSRNLQEFKPRSQ
MEIDFLELAMDEFIERYKLEGYAFEHIVYGDFSHSQLGGLHLLIGLAKRFKESPFELEDF
IPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSVVSKVVKVTIDYTEIS
FMLWCKDGHVETFYPKLQSSQAWQPGVAMPNLYKMQRMLLEKCDLQNYGDSATLPKGIMM
NVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLND
FVSDADSTLIGDCATVHTANKWDLIISDMYDPKTKNVTKENDSKEGFFTYICGFIQQKLA
LGGSVAIKITEHSWNADLYKLMGHFAWWTAFVTNVNASSSEAFLIGCNYLGKPREQIDGY
VMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKEGQINDMILSLLSKGRLII
RENNRVVISSDVLVNN
ORF1a polyprotein
MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV
LPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRK
VLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGG
AYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAW
YTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRI
RSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYL
PQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKC
AYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASF
SASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEA
ARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAY
ITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIV
GGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKC
VKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVG
TPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVN
ITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEW
SMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPL
EFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVV
QTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATN
NAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQ
HEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVE
QKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDIN
GNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKV
PTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLA
HAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLND
LNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEH
FIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLL
SLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYV
LPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATAL
LTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHAN
LDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQ
ESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYK
GPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVPNQPY
PNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFK
KGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWSTKPVETSNSFDVLKSEDAQGMDNLA
CEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYV
DNSSLTIKKPNELSRVLGLKTLATHGLAAVNSVPWDTIANYAKPFLNKVVSTTTNIVTRC
LNRVCTNYMPYFFTLLLQLCTFTRSTNSRIKASMPTTIAKNTVKSVGKFCLEASFNYLKS
PNFSKLINIIIWFLLLSVCLGSLIYSTAALGVLMSNLGMPSYCTGYREGYLNSTNVTIAT
YCTGSIPCSVCLSGLDSLDTYPSLETIQITISSFKWDLTAFGLVAEWFLAYILFTRFFYV
LGLAAIMQLFFSYFAVHFISNSWLMWLIINLVQMAPISAMVRMYIFFASFYYVWKSYVHV
VDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNCDTFCA
GSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSH
FVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAKSASVYYSQLMCQPILLLDQALVSDV
GDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQG
FVDSDVETKDVVECLKLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHIN
AQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIAL
KGGKIVNNWLKQLIKVTLVFLFVAAIFYLITPVHVMSKHTDFSSEIIGYKAIDGGVTRDI
ASTDTCFANKHADFDTWFSQRGGSYTNDKACPLIAAVITREVGFVVPGLPGTILRTTNGD
FLHFLPRVFSAVGNICYTPSKLIEYTDFATSACVLAAECTIFKDASGKPVPYCYDTNVLE
GSVAYESLRPDTRYVLMDGSIIQFPNTYLEGSVRVVTTFDSEYCRHGTCERSEAGVCVST
SGRWVLNNDYYRSLPGVFCGVDAVNLLTNMFTPLIQPIGALDISASIVAGGIVAIVVTCL
AYYFMRFRRAFGEYSHVVAFNTLLFLMSFTVLCLTPVYSFLPGVYSVIYLYLTFYLTNDV
SFLAHIQWMVMFTPLVPFWITIAYIICISTKHFYWFFSNYLKRRVVFNGVSFSTFEEAAL
CTFLLNKEMYLKLRSDVLLPLTQYNRYLALYNKYKYFSGAMDTTSYREAACCHLAKALND
FSNSGSDVLYQPPQTSITSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVY
CPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPK
TPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCV
SFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDR
WFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCASLKELLQNGMN
GRTILGSALLEDEFTPFDVVRQCSGVTFQSAVKRTIKGTHHWLLLTILTSLLVLVQSTQW
SLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWV
MRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYK
VYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIM
LVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKL
NIKLLGVGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLHNDILL
AKDTTEAFEKMVSLLSVLLSMQGAVDINKLCEEMLDNRATLQAIASEFSSLPSYAAFATA
QEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTY
KNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSD
GTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQAGNATEV
PANSTVLSFCAFAVDAAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITVTPEANMDQES
FGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCANDPVGFTLKNTVCTVCGMWKGYG
CSCDQLREPMLQSADAQSFLNGFAV
S1 Spike Protein
MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE
VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA
SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA
ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP
LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
SEPVLKGVKLHYT
ORF3a Protein
MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASLPFGWLIVGVALLAVFQSAS
KIITLKKRWQLALSKGVHFVCNLLLLFVTVYSHLLLVAAGLEAPFLYLYALVYFLQSINF
VRIIMRLWLCWKCRSKNPLLYDANYFLCWHTNCYDYCIPYNSVTSSIVITSGDGTTSPIS
EHDYQIGGYTEKWESGVKDCVVLHSYFTSDYYQLYSTQLSTDTGVEHVTFFIYNKIVDEP
EEHVQIHTIDGSSGVVNPVMEPIYDEPTTTTSVPL
ORF4 Structural Envelope Protein
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS
RVKNLNSSRVPDLLV
ORF5 Structural Membrane Glycoprotein
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPV TLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILL NVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYK LGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
ORF6 Protein
MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEI D
ORF7a Protein
MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFS TQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKT E ORF7b Protein
MIELSLIDFYLCFLAFLLFLVLIMLIIFWFSLELQDHNETCHA ORF8 Protein
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIEL CVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDF I
ORF9 Structural nucleocapsid phosphoprotein
MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHG
KEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAG
LPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGS
QASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQ
QQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKH
WPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAY
KTFPPTEPKKDKKKKADETQALPQRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA
ORF10 protein
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
4 Positively Charged Amino Acids in a row in the COVID Spike means it must have been Man Made: 'The laws of physics mean that you cannot have four positively charged amino acids in a row. The only way you can get this is if you artificially manufacture it,' - Prof Angus Dalgleish https://www.dailymail.co.uk/news/article-9629563/Chinese-scientists-created-COVID-19-lab-tried-cover-tracks-new-study-claims.html
The 3 positively charged essential Amino Acids are H, K, R.
There are two instances of these 4 consecutively in the ORF1ab and ORF1a polyproteins: KHKH. This codes for a non structural part of the virus, not for part of the spike protein.
There is one instance DEDEEE of 6 negatively charged consecutive amino acids as well in line 17.
Apparently all SARS Coronaviruses have KHKH once between the 2nd and 3rd hydrophobic transmembrane domains - https://www.mdpi.com/1999-4915/13/1/90/htm
The trouble is that the fruit fly, Drosophila Melanogaster, on the proteins coded for by the 4L Chromosome there are 2553 incidences of 4 adjacent positively charged amino acids and on the X Chromosome, there are 3,030 incidences. In fact it has the sequences
TNAEAAAAKKHKHQTKPTDSECEGKHKHKRNRNNVAGVQQHVLRLKLELQLLLCALLP - https://www.ncbi.nlm.nih.gov/nuccore/NC_004354.4
RRHRHRKRRDRNRVQRFGYEIHNVDEFLSRCSLATPGNIPVVLSTASTLYQTRPGGYQ - https://www.ncbi.nlm.nih.gov/nuccore/NT_037436.4
Which has incidences of KHKH in a 5 and in a 6 and in a 9 adjacent positively charged amino acid sequence. So much for the laws of Physics as interpreted by Prof Dalgleish and Dr Sorenson and reported in the Dailymail. That argument is plainly false.
The 20 Essential Amino Acids...
Charged | Polar | Amphipathic | Hydrophobic |
Lysine - K (+ve) Arginine - R (+ve) Histidine - H (+ve) Aspartic acid - D (-ve) Glutamic acid - E (-ve) |
Glutamine - Q Asparagine - N Histidine - H Serine - S Threonine - T Tyrosine - Y Cysteine - C |
Tryptophan - W Tyrosine - Y Methionine - M |
Alanine - A Isoleucine - I Leucine - L Methionine - M Phenylalanine - F Valine - V Proline - P Glycine - G |
The S1 protein Spike sequence is...
1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
2 NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
3 NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
4 GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
5 LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
6 CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
7 CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
8 YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
9 NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
10 FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
11 GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
12 ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
13 SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE
14 VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
15 LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
16 QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
17 TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA
18 SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA
19 ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP
20 LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
21 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
22 SEPVLKGVKLHYT
It does not contain the KHKH sequence.
However the Indian paper https://www.biorxiv.org/content/10.1101/2020.01.30.927871v1.full which has since been withdrawn, is more convincing.
https://www.reddit.com/r/C_S_T/comments/f5sosh/coronavirus_corvid2019_research/
- Anyone who has been following the story is probably aware of this research paper which has been attacked on social media by those who claim the conclusions drawn are incorrect. After examining the paper and reading the criticism I think they are lying to cover up the truth that this virus is a bio-weapon.
These scientists from India released this paper which examines the spike protein of the virus. The spike protein is the part of the virus that binds to the host cell. They found the genome of this virus spike protein was almost identical to the SARS virus except it is slightly longer because it has 4 extra sequences of amino acids. These are highlighted in Figure 2 which shows the Corvid19 genome compared directly against the SARS genome to show the four sequences of genetic code that are new.
These sections of new genetic code were found to match sequences of amino acids in the HIV-1 virus. The debunkers claim that is just a chance event and that these short sequences of amino acids mean nothing unusual.
Further examination reveals something else. Something that the debunkers have been very careful not to mention when they claim these extra sequences of genetic code are just random.
Although these 4 sequences of genetic code appear in figure 2, to be separate and not directly related to each other, when the genome is modelled in 3D shown below, we can see those 4 inserts of genetic code are all pieces that make the binding site. This is what makes the virus connect to its receptor in the host cell.
I contend that it is beyond improbable, that the new supposedly random genetic code just happened by chance to make the binding site in this virus and on top of that, just happened by chance to match genetic code from HIV. This virus did not just happen to evolve brand new sequences of genetic code in one generation that matches HIV when no other coronavirus has anything like this, not even the sample from the bats which are claimed to have transmitted it to humans has this new code. I believe this is because it is bio-engineered, this new, extra genetic code has been cut from HIV and spliced into the SARS virus to create an enhanced, more deadly version of it.
The analysis above was posted by u/Raven9hine9 on Reddit in 2019. Prof Luc Montagnier, who won the Nobel prize for discovering the HIV virus, deduced that COVID-19 was man made in 2020 and was attacked by all and sundry as a result (all those funded by big Pharma)...
But now on 2021Septmber23 thanks to a leak from DARPA, we discover that Peter Daszak and the Eco Health Alliance in 2018 submitted a proposal to DARPA to do gain of function research on SARS coronaviruses to insert is furin cleavage site (such as is found in HIV1) in an optimal position into the coronavirus gene. COVID-19 has a furin cleavage site optimally positioned to infect humans - https://theintercept.com/2021/09/23/coronavirus-research-grant-darpa/
Alina Chan, a Boston-based scientist and co-author of the upcoming book “Viral: The Search for the Origin of Covid-19" now says the following....
“Let’s look at the big picture: A novel SARS coronavirus emerges in Wuhan with a novel cleavage site in it. We now have evidence that, in early 2018, they had pitched inserting novel cleavage sites into novel SARS-related viruses in their lab,” said Chan. “This definitely tips the scales for me. And I think it should do that for many other scientists too.”
https://www.documentcloud.org/documents/21066966-defuse-proposal
- this is the Eco health alliance DARPA funding proposal.
Oh dear. That really nails it. DARPA confirms that Peter Daszak of the Eco Health Alliance submitted a proposal on 2018March27 to add an HIV1 type furin cleavage site to SARS1 and SARS CoV 2 has that furin cleavage site. Fauci funded Wuhan through the Eco Health Alliance.
As of September 2021 48465 people are recorded as having died within 14 days of being vaccinated in the CMS database, 19400 under 80 and 28065 over 80 years old
The population of the US is 330m and 378m vaccine doses have been given on 2021Sept1. So the average person had 1.15 shots by then.
The average age of people on Medicare is 70 (Medicare in only available to those over 65 or with disabilities or on dialysis)
So their life expectancy is around 15 years - https://coolconversion.com/heath/life-expectancy-calculator-us/I-am_70_years-old.-What-is-my-life-expectancy%3F_m
So we can expect 59.4 million medicare deaths in 15 years or 3.96m deaths per year or 10,849 deaths per day.
The vaccination rate among Medicare over 65 year olds was 80% by July (https://www.humetrix.com/powerpoint-vaccine.html) and of course they had a 0% vaccination rate at the start of the vaccinations in February. So the average vaccination rate from February to September is 40% from Feb to July for 6 months and 80% in August for 1 month, giving 46% for the whole period
So the number who would have died normally within 14 days of a 2nd jab (assuming 46% are vaccinated on average through the vaccinating period) is 14x0.46x10849 =
69,867
Which is more than the 48,465 death logged. This must mean that there is a lag between a death and an entry in the Medicare databse.
https://www.infowars.com/posts/bombshell-from-attorney-thomas-renz-nearly-50k-medicare-patients-died-soon-after-getting-covid-shot/
https://www.brighteon.com/9c9e7922-5290-4591-a60e-0311b2cdf957
To prove he does actually have this data from CMS Thomas Lenz provides the following slide presentation in pdf format - https://renz-law.com/wp-content/uploads/covid-presentation-sept-2021.pdf
There were 3.7m people on Medicare and a further 800,000 on Medicare-Medicaid in New York State in 2020 - https://www.healthinsurance.org/medicare/new-york/
But we take the total in the CMS Medicare database for New York state as 3.75m.
Here is the 2021 September database showing adverse reactions and deaths within 28 days of a shot
There were 6586 deaths in New York State within 28 days of shot
We can expect 3.75 million medicare deaths in 15 years or 0.247m deaths per year or 677 deaths per day for Medicare New Yorkers
As above around 46% on average were vaccinated from February1 to September1
Then the number of people who would have died anyway within 28 days of a shot is 28 x 0.46 x 677 = 8720
Which again is more than the 6586 actually logged.
Natural immunity results from showing the immune system the entire COVID-19 virus. Vaccine immunity results from showing it a computerized approximation to one spike protein of the virus.
The immune system either chops up the entire virus and makes hundreds of different antibodies to all of its parts, or it chops up the computerized spike approximation and makes a few different antibodies to parts of the spike.
If a new variant has a slightly different spike, then vaccine immunity may fail, because it only recognises the previous version of the spike. Whereas natural immunity will succeed because it recognises every part of the virus, not just the altered spike.
The above is basic virology and immunology. The fact that governments are enforcing vaccine mandates upon people with natural immunity and falsely representing that vaccine immunity is the only type necessary to protect people and refusing to recognise the superior immunity resulting from prior infection proves that they are not interested in true immunity at all and are merely pushing vaccines and vaccine passports.
The fact they they have vaccinated millions of adults and now even children who already had natural immunity shows that this is all about coerced vaccination and not about immunity or health. The fact that they are now sacking unvaxxed health care workers (who are 25% less likely to catch delta than doubly vaxxed health care workers from PHEs latest figures Technical Briefings 17-23) shows that they do not care about health. They care only about vaccination.
The immune system of someone who has recovered from the disease has already seen the entire COVID-19 virus. It will gain noting from being reintroduced to a computerised approximation to one part of that virus. Vaccination of recovered people is all risk and no benefit. Everyone who has recovered should be given:
Do not vaccinate status.
https://www.gov.uk/government/publications/jcvi-statement-september-2021-covid-19-vaccination-of-children-aged-12-to-15-years/jcvi-statement-on-covid-19-vaccination-of-children-aged-12-to-15-years-3-september-2021
- the JCVI recommends against vaccinating 12-15 year olds.
www.lordswitnesses.net/downloads/Humetrix1.pdf
https://dreddymd.files.wordpress.com/2021/10/salus_humetrix_ve_study_2021_09_28-2.pdf
The pandemic was over for Wuhan alpha in the unvaxxed in June. then the vaxxed dragged them out of herd immunity again in July. Then extrapolating the pandemic would be over for Delta in the unvaxxed in November.
The purpose of government Covid statistics is no longer to inform the public with scientific truth, in order to help them formulate a valid medical decision on the risks and benefits of Covid Vaccines. It is to influence the public with misleading or false or politically biased or medically biased information and to suppress any information which does not suit their political agenda in order to effectively make that choice for them
On November2, the Daily Mail published an article revealing that...
1. UK statistics watchdog scolds PHE's replacement body for publishing 'misleading' figures which anti-vaxxers have seized as proof that Covid jabs don't work
2. Over the past few weeks, the agency's data shows infection rates are higher in fully-vaccinated adults compared to the unjabbed.
3. Anti-vaxx commentators and campaigners have seized the data as proof that Covid vaccines don't work.
The UK's Statistics Watchdog is The Office of Statistics Regulation (TOSR for short). Yes Offstats has told the UKHSA that their Stats are off. And now they are nicely back on message.
TOSR director general Ed Humpherson yesterday wrote to the UKHSA's boss Dr Jenny Harries on November1 thanking her for the changes she had made and is quoted in the Daily Mail as saying
'It remains the case that the surveillance report includes rates per 100,000 which can be used to argue that vaccines are not effective,'
'I know that this is not the intention of the surveillance report, but the potential for misuse remains.
There is the tacit admission by the Government that the purpose of their stats is not to enable the public to decide for themselves whether the vaccines are effective or not. No their stats should not even be able to support an argument that the vaccines are ineffective. Indeed any such construction of UKHSA statistics would be a misuse of government data according to the Director General. This is his candid admission that the use of all UKHSA data is exclusively to prove the vaccines are effective. And any government statistics agency which departs from that line shall be re-adjusted by TOSR. He is defining the UKHSA as a pro vaccine propaganda outfit, whose mandate is only to supply information for one side of the debate. No person in the UK can be expected to make an informed choice of whether to take Pfizer's experimental gene therapy when it is presented to them by the government as an unquestionably effective Covid vaccination.
https://www.dailymail.co.uk/health/article-10155799/Stats-watchdog-scolds-PHE-replacement-data-misuse-supports-anti-vaxxers.html'
The writer therefore calls on Ed Humpherson, to
1. Withdraw his instruction to the UKHSA to only present data that supports vaccination and to suppress data that has the capability of being used to support vaccine refusal. Because the law requires that the public are given the opportunity to give an informed consent for all medical interventions.
2. To publish forthwith under a Freedom of Information Request, Any and All instructions to other government agencies to the same purpose, namely of influencing the public with one sided propaganda, rather than informing it in a balanced manner with both sides of the argument.
3. To publicly withdraw all such instructions and start presenting the truth to the British people and trust them to make the best decision for themselves,
their families and their children.
The 8 Public Health England (PHE) tables below from their excellent (up to Week 42) Vaccine Surveillance Report of all fully genome sequenced UK delta cases (mainly using a genome identifying PCR test), separated by 7 weeks, clearly show the progressive damage that the vaccines are doing to the immune response of the doubly vaxxed. PHE have done so much great work and the picture continues to be so clear.
Here is the weekly decline in doubly vaccinated immune system performance compared to unvaxxed people. Vaccine efficacy is measured using Pfizer's vaccine effectiveness formula...
(Unvaxxed case rate - Vaxxed case rate)/the Larger of Unvaxxed or Vaxxed case rate - We are using the normalised absolute ratio of vaxxed to unvaxxed case numbers to determine vaccine efficiency just as Pfizer itself does.
Age group | Week35 Vaccine Efficacy |
Week36 Decline |
Week37 Decline |
Week38 Decline |
Week39 Decline |
Week40 Decline |
Week41 Decline |
Week42 Decline |
Week43 Decline |
Week44 Decline |
Week45 Decline |
Week46 Decline |
Week47 Decline |
Week48 Decline |
Week49 Decline |
Week50 Decline |
Dec17 Vaccine Efficacy |
Average Weekly Decline 35-42 |
Weeks from week50 (Nov11-Dec17) before immune system failure (100% degradation) |
CHILDREN | +60.1% | +6.4% | +11.6% | +5.7% | +4.3% | +1.6% | 0% | -8.2% | +6.6% | -9.7% | -1.4% | +0.6% | +1.7% | +1.1% | +2.7% | -4.4% |
+78.6% |
-5.5% from peak | 33 weeks (181.4/5.5) |
18-29 | +53.2% | -2.5% | -1.9% | -4.0% | -4.3% | -7.0% | -8.6% | -4.0% | -7.5% | -0.2% | -1.8% | -1.8% | -1.0% | -3.7% | -14.1% | -33.7% |
-42.9% |
-4.6% | 13 weeks (57.1/4.6) |
30-39 | +31.6% | -6.0% | -7.0% | -10.5% | -11.4% | -10.5% | -7.7% | -2.2% | -3.2% | -0.3% | -0.7% | -1.7% | -0.9% | -2.4% | -3.4% | -13.1% |
-49.4% |
-7.9% | 7 weeks (50.6/7.9) |
40-49 | -21.1% | -5.2% | -5.3% | -8.1% | -6.9% | -5.6% | -3.2% | -1.6% | +0.8% | +0.3% | +1.3% | +0.7% | +0.1% | -0.8% | +0.1% | -2.3% |
-56.7% |
-5.1% | 9 weeks (43.3/5.1) |
50-59 | -24.1% | -4.0% | -2.4% | -3.9% | -5.7% | -5.7% | -5.0% | -2.3% | -0.3% | -0.4% | +1.6% | +1.2% | +1.6% | +2.1% | +3.1% | -0.2% |
-44.4% |
-4.1% | 12 weeks (55.6/4.1) |
60-69 | -27.5% | -4.2% | -2.9% | -4.2% | -2.1% | -5.8% | -4.0% | -2.5% | -0.7% | -0.5% | +1.1% | +2.9% | +5.9% | +8.1% | +11.6% | +4.5% |
-20.3% |
-3.7% | 14 weeks (79.7/3.7) |
70-79 | -23.5% | -4.1% | +0.7% | -3.9% | -3.6% | -9.6% | -6.3% | -0.6% | +1.3% | +4.0% | +9.3% | +14.8% | +24.5% | +23.6% | +12.9% | -5.5% |
+34.0% |
-3.9% | 35 weeks (134.0/3.9) |
80+ | +8.5% | -5.6% | -7.1% | -3.1% | -2.5% | -8.3% | -7.1% | +2.4% | +0.9% | +13.7% | +16.5% | +19.5% | +11.5% | +7.5% | +6.5% | -2.6% |
+50.7% |
-4.5% | 34 weeks (150.7/4.5) |
18+ | -0.4% | -4.5% | -3.7% | -5.4% | -5.2% | -7.5% | -6.0% | -1.5% | -1.2% | +2.4% | +3.9% | +5.1% | +6.0% | +4.9% | +2.3% | -5.2% |
-18.4% |
-4.8% | 17.7 weeks |
Projected Vaccine efficacy ignoring the effect of the 3rd Jab which gives a temporary improvement in immune response together with a faster degradation which cancels the improvement out after around 3 months we suspect.
Age group | Week35 Vaccine Efficacy |
Week36 Decline |
Week37 Decline |
Week38 Decline |
Week39 Decline |
Week40 Decline |
Week41 Decline |
Week42 Decline |
Week43 Decline |
Week44 Decline |
Week45 Decline |
Week46 Decline |
Week47 Decline |
Week48 Decline |
Week49 Decline |
Week50 Decline |
Dec17 Vaccine Efficacy |
Average Weekly Decline 35-42 |
Weeks from week50 (Nov11-Dec17) before immune system failure (100% degradation) |
CHILDREN | +60.1% | +6.4% | +11.6% | +5.7% | +4.3% | +1.6% | 0% | -8.2% | -5.5% | -5.5% | -5.5% | -5.5% | -5.5% | -5.5% | -5.5% | -5.5% | +37.4% | -5.5% from peak | 25 weeks (137.4/5.5) |
18-29 | +53.2% | -2.5% | -1.9% | -4.0% | -4.3% | -7.0% | -8.6% | -4.0% | -4.6% | -4.6% | -4.6% | -4.6% | -4.6% | -4.6% | -4.6% | -4.6% | -15.9% | -4.6% | 19 weeks (84.1/4.6) |
30-39 | +31.6% | -6.0% | -7.0% | -10.5% | -11.4% | -10.5% | -7.7% | -2.2% | -7.9% | -7.9% | -7.9% | -7.9% | -7.9% | -7.9% | -7.9% | -7.9% | -86.9% | -7.9% | 2 weeks (13.1/7.9) |
40-49 | -21.1% | -5.2% | -5.3% | -8.1% | -6.9% | -5.6% | -3.2% | -1.6% | -5.1% | -5.1% | -5.1% | -5.1% | -5.1% | -5.1% | -5.1% | -5.1% | -97.7% | -5.1% | 1 week (2.3/5.1) |
50-59 | -24.1% | -4.0% | -2.4% | -3.9% | -5.7% | -5.7% | -5.0% | -2.3% | -4.1% | -4.1% | -4.1% | -4.1% | -4.1% | -4.1% | -4.1% | -4.1% | -85.9% | -4.1% | 4 weeks (14.1/4.1) |
60-69 | -27.5% | -4.2% | -2.9% | -4.2% | -2.1% | -5.8% | -4.0% | -2.5% | -3.7% | -3.7% | -3.7% | -3.7% | -3.7% | -3.7% | -3.7% | -3.7% | -82.8% | -3.7% | 5 weeks (17.2/3.7) |
70-79 | -23.5% | -4.1% | +0.7% | -3.9% | -3.6% | -9.6% | -6.3% | -0.6% | -3.9% | -3.9% | -3.9% | -3.9% | -3.9% | -3.9% | -3.9% | -3.9% | -82.1% | -3.9% | 5 weeks (17.9/3.9) |
80+ | +8.5% | -5.6% | -7.1% | -3.1% | -2.5% | -8.3% | -7.1% | +2.4% | -4.5% | -4.5% | -4.5% | -4.5% | -4.5% | -4.5% | -4.5% | -4.5% | -58.8% | -4.5% | 10 weeks (41.2/4.5) |
18+ | -0.4% | -4.5% | -3.7% | -5.4% | -5.2% | -7.5% | -6.0% | -1.5% | -4.8% | -4.8% | -4.8% | -4.8% | -4.8% | -4.8% | -4.8% | -4.8% | -72.6% | -4.8% | 6.6 weeks |
A Vaccine efficacy of +50% means that doubly vaxxed people are 50% more protected from Covid than unvaxxed people. It means that the delta case rate in the vaxxed is half the delta case rate in the unvaxxed.
A Vaccine efficacy of -50% means that unvaxxed people are 50% more protected from Covid than doubly vaxxed people. It means that the delta case rate in the vaxxed is double the delta case rate in the unvaxxed.
A Vaccine efficacy of 0% means that doubly vaccinated people are 0% more protected from Covid than unvaxxed people. It means that the delta case rate in the vaxxed equals the delta case rate in the unvaxxed. It means the vaccines have lost all their effectiveness.
Age group | Week35 Vaccine Efficacy |
Week36 Vaccine Efficacy |
Week37 Vaccine Efficacy |
Week38 Vaccine Efficacy |
Week39 Vaccine Efficacy |
Week40 Vaccine Efficacy |
Week41 Vaccine Efficacy |
Week42 Vaccine Efficacy |
Week43 Vaccine Efficacy |
Week44 Vaccine Efficacy |
Week45 Vaccine Efficacy |
Week46 Vaccine Efficacy |
Week47 Vaccine Efficacy |
Week48 Vaccine Efficacy |
Week49 Vaccine Efficacy |
Week50 Vaccine Efficacy |
CHILDREN | +60.1% | +66.4% | +78.0% | +83.7% | +88.0% | +89.6% | +89.6% | +81.4% | +88.0% |
+78.3% |
+76.90% |
+77.5% |
+79.2% | +80.3% | +83.0% |
+78.6% |
18-29 | +53.2% | +50.7% | +48.8% | +44.8% | +40.5% | +33.5% | +24.9% | +20.9 | +13.4% |
+13.2% |
+11.40% |
+9.6% |
+8.6% | +4.9% | -9.2% |
-42.9% |
30-39 | +31.6% | +25.6% | +18.6% | +8.1% | -3.3% | -13.8% | -21.5% | -23.7% | -26.9% | -27.2% |
-27.90% |
-29.6% |
-30.5% | -32.9% | -36.3% |
-49.4% |
40-49 | -21.1% | -26.3% | -31.6% | -39.7% | -46.6% | -52.2% | -55.4% | -56.9% | -56.1% | -55.8% |
-54.50% |
-53.8% |
-53.7% | -54.5% | -54.4% |
-56.7% |
50-59 | -24.1% | -28.1% | -30.5% | -34.4% | -40.1% | -45.8% | -50.8% | -53.1% | -53.4% | -53.8% |
-52.20% |
-51.0% |
-49.4% | -47.3% | -44.2% |
-44.4% |
60-69 | -27.5% | -31.7% | -34.6% | -38.8% | -40.9% | -46.7% | -50.7% | -53.2% | -53.9% | -54.4% |
-53.30% |
-50.4% |
-44.5% | -36.4% | -24.8% |
-20.3% |
70-79 | -23.5% | -27.6% | -26.9% | -30.8% | -34.4% | -44.0% | -50.3% | -50.9% | -49.6% |
-45.6% |
-36.30% |
-21.5% |
+3.0% | +26.6% | +39.5% |
+34.0% |
80+ | +8.5% | +2.9% | -4.2% | -7.3% | -9.8% | -18.1% | -25.2% | -22.8% | -21.9% | -8.2% |
+8.30% |
+27.8% |
+39.3% | +46.8% | +53.3% |
+50.7% |
18+ | -0.4% | -4.9% | -8.6% | -14.0% | -19.2% | -26.7% | -32.7% | -34.2% | -35.5% | -33.1% |
-29.2% |
-24.1% |
-18.1% | -13.3% | -10.9% |
-18.4% |
And now, as if by magic, the consistent pattern of the 7 weeks from week35 - week41, has miraculously slowed down and stopped altogether. Well Hallelujah - we are delivered from vaccine induced AIDS coincident with a scolding by the government of its statistics agency.
The writer is not buying this miracle cure and is still projecting the same result that the unmassaged data from Weeks35-41 predict, namely...
The 8 UK PHE Vaccine Surveillance Report figures on Covid cases from Week35-42 showed that doubly vaccinated 40-79 year olds had lost lost 50% of their immune system capability by October 24 and are consistently losing a further 4-5% every week (between 3.7% and 7.9%). Not withstanding what we understand to be the corrupted figures for Week43, we continue to project that 30-49 year olds will have zero Covid/viral defence at best, or a form of vaccine mediated AIDS at worst, by the first week in January and all doubly vaccinated people over 30 will have completely lost that part of their immune system which deals with Covid in the next 17 weeks.
https://www.infowars.com/posts/hospitals-in-america-australia-and-sweden-are-swamped-with-people-sicker-than-ever-and-they-dont-have-covid/
https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/
These figures up to Week42 show that children beginning to suffer immune system degradation which is despicable news. Their vaccine efficacy figures went up due to more and more 12-15 year olds being included in the cohort since Chris Whitty overruled the Joint Committee on Vaccination and Immunisation. They have now just about finished being included. So the slow degradation can now begin to be seen.
At the other end of the age scale, the 80+ group saw a major improvement in Week42, due to the boosters which will buy them a couple of months of improved covid immunity which will hide the continuing gradual immune system degradation. These boosters are the same as the original vaccinations (because no other shot has yet been approved and because the drug companies have so far only been indemnified against the original vaccines). So the worry is that whilst, Covid-19 immunity may be improved for a couple of months, their general immunity is now degrading even faster than it would have done had the booster not been taken. We shall see if that turns out to be the case from future data.
The 70-79 year olds are also seeing a slow down in apparent degradation due to the boosters improving their Covid response. It may also be the case that other age groups are already taking boosters. There is no shortage of places who will vaccinate people on demand without offering the necessary information for giving an informed consent. The latest clinical information detailed below is terminal for vaccines and boosters.
The risk benefit analysis for these vaccines has now become a risk detriment analysis for everyone over 30.
Basic Immunology
Vaccines work by simulating a viral attack and provoking the immune system into responding as if you have had the virus. They are supposed to train the immune system to the point where you develop natural immunity to the virus. So the argument that vaccine immunity is better than natural immunity could never have been true because vaccine immunity is an inferior form of natural immunity resulting from the body's immune response to a vaccine generated simulation rather than to a real world infection. The vaccines program your cells to produce the 1273 Amino Acid S1 Spike Protein, which for the sake of completeness is presented below, with 60 amino acids per line..
1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFS
2 NVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIV
3 NNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLE
4 GKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQT
5 LLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETK
6 CTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISN
7 CVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
8 YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPC
9 NGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVN
10 FNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITP
11 GTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSY
12 ECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTI
13 SVTTEILPVSMTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQE
14 VFAQVKQIYKTPPIKDFGGFNFSQILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDC
15 LGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSALLAGTITSGWTFGAGAALQIPFAM
16 QMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQDVVNQNAQALN
17 TLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRA
18 SANLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPA
19 ICHDGKAHFPREGVFVSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDP
20 LQPELDSFKEELDKYFKNHTSPDVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDL
21 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSCGSCCKFDEDD
22 SEPVLKGVKLHYT
Here is the Amino Acid Look up table...
Charged | Polar | Amphipathic | Hydrophobic |
Lysine - K (+ve) Arginine - R (+ve) Histidine - H (+ve) Aspartic acid - D (-ve) Glutamic acid - E (-ve) |
Glutamine - Q Asparagine - N Histidine - H Serine - S Threonine - T Tyrosine - Y Cysteine - C |
Tryptophan - W Tyrosine - Y Methionine - M |
Alanine - A Isoleucine - I Leucine - L Methionine - M Phenylalanine - F Valine - V Proline - P Glycine - G |
Whereas the SARS-CoV-2 isolated from Ethiopian patients had: genome sizes were 29,860, 29,856, and 29,871 - https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8459669/
There are 3 nucleotides (genome RNA bases) per Amino Acid. So Covid-19 has around 9953 Amino Acids in total. The virus is therefore around 8x larger than its spike protein. Vaccine immunity results from antibodies to the spike protein. Natural immunity results from antibodies to the entire virus. The immune system chops up virus proteins into small sections and produces a different antibody for each section. So natural immunity will produce 8x as many antibody types as virus immunity. This is one reasons why it is so much better.
In one analysis that compared more than 32,000 people, they found that the risk of developing symptomatic COVID-19 was 27 times higher among the vaccinated, and the risk of hospitalisation 8 times higher - https://thepulse.one/2021/08/29/covid-infection-provides-greater-protection-than-being-fully-vaccinated-new-study/
and https://www.medrxiv.org/content/10.1101/2021.08.24.21262415v1.
Simply put natural immunity is 8x as broad based as vaccine immunity for Covid19 spike protein vaccines.
Vaccines do two things for the immune system. They show it the enemy and they agitate the immune system to simulate a systemic infection, to persuade it that the enemy it is being shown is really dangerous. This persuades the immune system to rush off and make loads of antibodies which can take out the offending cut up sections of the enemy protein, the spike protein, for Covid vaccines.
The purpose of the above mini course in basic immunology is to educate the reader to the point where they understand that vaccines cannot lose effectiveness. Vaccines are DIGITAL. They are not ANALOGUE. They offer a 2-3 week training course to the immune system which either works or does not work. After that they have nothing whatsoever to do. They carry out no further process which can lose efficiency. Either they show the immune system part of the virus and alert it to the danger it poses or they do not. We know that the covid19 vaccines work initially, from the initial case number results. So they succeed in training the immune system. At the point their job is done. They have nothing more to do. There is no immunological mechanism by which vaccines can lose their efficiency because they have finished the purpose of their existence within 2-3 weeks, the normal period of a viral infection. The concept that they lose efficiency after 2-3 weeks is just immunological nonsense.
So the rapid deterioration in immune response to Covid19 post vaccination can only be due to the vaccines damaging the immune system. It cannot be due to them 'losing efficiency'. The fact that the boosters do improve covid response (by alerting the immune system even more and telling it that covid19 - which has already been identified twice by the first two shots, is really really really dangerous and it had better go to defcon3) shows categorically that vaccines have not lost their efficacy. Their training program is still effective. So the deterioration in immune response is an unwanted side effect of the vaccination. It is the gene therapy part of the vaccines. It is the continual over production of spike proteins that appears to wear out the poor old immune system. And boosters will make that worse.
Swedish Researchers have discovered one mechanism through which the Vaccines damage the immune system
SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination In Vitro
- https://www.mdpi.com/1999-4915/13/10/2056/htm
by Hui Jiang and Ya-Fang Mei
Department of Molecular Biosciences, The Wenner–Gren Institute, Stockholm University, SE-10691 Stockholm, Sweden and Department of Clinical Microbiology, Virology, Umeå University, SE-90185 Umeå, Sweden
Abstract
Severe acute respiratory syndrome coronavirus 2 (SARS–CoV–2) has led to the coronavirus disease 2019 (COVID–19) pandemic, severely affecting public health and the global economy. Adaptive immunity plays a crucial role in fighting against SARS–CoV–2 infection and directly influences the clinical outcomes of patients. Clinical studies have indicated that patients with severe COVID–19 exhibit delayed and weak adaptive immune responses; however, the mechanism by which SARS–CoV–2 impedes adaptive immunity remains unclear. Here, by using an in vitro cell line, we report that the SARS–CoV–2 spike protein significantly inhibits DNA damage repair, which is required for effective V(D)J recombination in adaptive immunity. Mechanistically, we found that the spike protein localizes in the nucleus and inhibits DNA damage repair by impeding key DNA repair protein BRCA1 and 53BP1 recruitment to the damage site. Our findings reveal a potential molecular mechanism by which the spike protein might impede adaptive immunity and underscore the potential side effects of full-length spike-based vaccines.
The problem with this study is not merely that mRNA vaccines, by creating spike proteins, prevent your DNA from repairing itself which will cause immunological disorders, cancer and premature ageing. The problem is that the spike proteins are going into your cell nuclei, which may well open the door for the mRNA to follow. That is straight gene therapy not vaccination. mRNA should go directly to the protein assembly plants in your cells called ribosomes, which it should instruct to manufacture the spike protein. It should not be going anywhere near the cell nucleus. Entering the cell nucleus means it is performing or effectively performing reverse transcription and making itself a part of, or an addition to, your genetic code.
SARS-CoV-2 RNA reverse-transcribed and integrated into the human genome https://pubmed.ncbi.nlm.nih.gov/33330870/
Reverse-transcribed SARS-CoV-2 RNA can integrate into the genome of cultured human cells and can be expressed in patient-derived tissues - https://pubmed.ncbi.nlm.nih.gov/33958444/
Latest Projections
Everybody over 30 will have lost 100% of their entire immune capability (certainly for Covid and most likely for viruses and certain cancers - following the evidence from Cole Diagnostics in Idaho and Dr Nathan Thompson and Dr Ralph Baric) within 18 weeks.
Doubly vaccinated 30-49 year olds will have lost it by the 1st week in January. These people will then have no immune defence to Covid-19 at all. The question then becomes how much of the immune system is involved in defending against Covid-19? The worst case scenario is that they effectively develop full blown Acquired Immune Deficiency Syndrome and destroy the NHS.
"In individuals aged greater than 30, the rate of positive COVID-19 test is higher in vaccinated individuals compared to unvaccinated". - PHE Vaccine Surveillance Report for week 41.
“There is the potential for ADE, but the bigger problem is probably Th2 immunopathology,” says Ralph Baric, an epidemiologist and expert in coronaviruses—named for the crown-shaped spike they use to enter human cells—at the University of North Carolina at Chapel Hill.
In previous studies of SARS, aged mice were found to have particularly high risks of life-threatening Th2 immunopathology in which a faulty T cell response triggers allergic inflammation, and poorly functional antibodies that form immune complexes, activating the complement system and potentially damaging the airways.
Baric expresses his concern about what that might mean for use of a COVID-19 vaccine in elderly people. “Of course, the elderly are our most vulnerable population,” he adds. - https://www.pnas.org/content/117/15/8218 (the Proceedings of the National Academy of Sciences of the USA)
The underlined passage (which has been redacted from the online PNAS report - but is in many other online copies - https://principia-scientific.com/study-covid-19-vaccine-can-destroy-your-immune-system/) is critical as it relates to an immune deficiency in killer T cells.
This was seen by Dr Ryan Cole who has done over 100,000 pathology lab examinations from Covid patients. He identified it as a form of AIDS (reverse HIV he called it - where you lose CD8 killer T cells rather than CD4 Helper T cells). Ralph Baric should know. In 2002 on April 19, the University of North Carolina filed US patent 7279327 for an infectious replication defective coronavirus (to be used as a virus vector for an HIV vaccine), claiming priority from US28531801P. Inventors were: Kristopher M. Curtis, Boyd Yount, Ralph S. Baric
These immune system degradations could be caused by ADE (Antibody Dependent Enhancement - where vaccine induced antibodies start working in reverse) and be specific to Covid, or could be more general and result in a form of vaccine mediated AIDS (Acquired Immune Deficiency Syndrome). Baric suspects the latter above.
The fact that the 3rd Jabs worked in Israel (for a short period of time before the 4th jabs were proposed) means that vaccine antibodies do still have a protective effect immediately after vaccination. So that may rule out ADE. Furthermore the latest figures for the 70-79 and 80+ age groups, show that boosters do improve the immune response or at least slow its degradation in the short term. So booster generated antibodies do not appear to be suffering from ADE in the short term.
The falling efficacy of the vaccines does not asymptotically approach zero (which would mean that vaccines merely lose effectiveness over time). It goes straight through zero and then goes dangerously negative (which means the vaccines become toxic to the immune system). Then it goes more negative in a linear manner week on week. If this continues then the vaccines will completely destroy the part of the immune system which deals with Covid in all over 30s by the end of January.
This may well result in more cases of Shingles, HPV, Herpes, Epstein Barr, Endometriosis and other viral infections - https://www.nbc12.com/2021/10/15/reports-shingles-outbreaks-not-directly-linked-covid-19-vaccine/
HARRISONBURG, Va. (WHSV) - There have been case studies showing people are experiencing recurrences or outbreaks of shingles after getting the COVID-19 vaccine. Local doctors say that is rare and not necessarily caused by the vaccine.
“I’ve seen a lot of shingles recently, but I haven’t seen it associated with the vaccine personally. That’s my personal experience,” Dr. Jennifer Derby, a family physician with Sentara RMH, said. (2021October15)
Tables 2 and 5. COVID-19 cases by vaccination status...
The immune system boost or degradation column, which is the vaccine efficiency/inefficiency column, column10, is calculated from Pfizer's vaccine efficiency formula of
U-V/U for U>V and U-V/V for V>U
Which formula they used to claim 95% vaccine efficiency against Wuhan Hu1 from a 20:1 case number ratio. .
Cases reported by specimen date between week 32 & 35 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1016465/Vaccine_surveillance_report_-_week_36.pdf
Age group | Total Cases | Vax Status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Under 18 | 167,832 | 15,901 | 8,132 | 1,368 | 757 | 141,676 | 476.0 | 1,192.9 | +60.1% (excludes 12-15 year olds) |
18-29 | 176,392 | 19,529 | 4,598 | 66,545 | 32,533 | 53,187 | 711.1 | 1,520.8 | +53.2% |
30-39 | 113,373 | 12,452 | 1,497 | 22,434 | 43,004 | 33,986 | 782.2 | 1,143.9 | +31.6% |
40-49 | 97,881 | 8,930 | 496 | 6,000 | 67,349 | 15,106 | 1,116.2 | 880.4 | -21.1% |
50-59 | 84,488 | 6,868 | 168 | 2,248 | 67,652 | 7,552 | 962.0 | 729.7 | -24.1% |
60-69 | 45,252 | 3,657 | 54 | 772 | 38,119 | 2,650 | 672.3 | 487.5 | -27.5% |
70-79 | 25,499 | 2,034 | 12 | 273 | 22,270 | 910 | 480.5 | 367.5 | -23.5% |
80+ | 12,011 | 1,124 | 9 | 246 | 10,087 | 545 | 391.1 | 427.4 | +8.5% |
Cases reported by specimen date between week 33 & 36 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1018416/Vaccine_surveillance_report_-_week_37_v2.pdf
Age group | Total Cases | Vax Status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Incline/ Decline |
Under 18 | 190,863 | 16,825 | 9,812 | 1,999 | 809 | 161,418 | 458.2 | 1,362.3 | +66.4% (includes 20k 12-15 cases) | +6.3% |
18-29 | 145,087 | 15,923 | 3,280 | 50,338 | 31,091 | 44,455 | 633.3 | 1,284.9 | +50.7% | -2.5% |
30-39 | 105,839 | 11,081 | 1,225 | 17,273 | 44,683 | 31,577 | 795.9 | 1,069.8 | +25.6% | -6.0% |
40-49 | 98,990 | 8,593 | 426 | 5,215 | 70,186 | 14,570 | 1,157.3 | 852.6 | -26.3% | -5.2% |
50-59 | 84,468 | 6,559 | 145 | 2,080 | 68,469 | 7,215 | 972.1 | 699.2 | -28.1% | -4.0% |
60-69 | 46,557 | 3,462 | 51 | 766 | 39,686 | 2,592 | 699.5 | 477.7 | -31.7% | -4.2% |
70-79 | 26,937 | 2,012 | 8 | 260 | 23,739 | 918 | 512.3 | 371.1 | -27.6% | -4.1% |
80+ | 12,563 | 1,142 | 9 | 256 | 10,616 | 540 | 412.3 | 424.5 | +2.9% | -5.6% |
Cases reported by specimen date between week 34 & 37 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1019992/Vaccine_surveillance_report_-_week_38.pdf
Age group | Total Cases | Vax Status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 219,031 | 17,862 | 9,288 | 2,740 | 673 | 188,468 | 349.5 | 1,592.2 | +78.0% (includes 50k 12-15 cases) | +11.6% |
18-29 | 109,093 | 12,556 | 2,221 | 31,099 | 27,441 | 35,776 | 533.5 | 1,041.7 | +48.8% | -1.9% |
30-39 | 95,772 | 9,698 | 982 | 12,940 | 44,193 | 27,959 | 775.2 | 952.9 | +18.6% | -7.0% |
40-49 | 96,254 | 7,930 | 349 | 4,439 | 70,141 | 13,395 | 1,151.2 | 787.1 | -31.6% | -5.3% |
50-59 | 78,706 | 5,897 | 115 | 1,811 | 64,356 | 6,527 | 912.3 | 634.4 | -30.5% | -2.4% |
60-69 | 43,850 | 3,228 | 35 | 711 | 37,535 | 2,341 | 661.2 | 432.1 | -34.6% | -2.9% |
70-79 | 25,712 | 1,798 | 7 | 222 | 22,796 | 889 | 492.0 | 359.8 | -26.9% | +0.7% |
80+ | 12,164 | 1,077 | 7 | 221 | 10,369 | 490 | 403.4 | 386.1 | -4.2% | -7.1% |
Cases reported by specimen date between week 35 & 38 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1022238/Vaccine_surveillance_report_-_week_39.pdf
Age group | Total Cases | Vax Status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 273,685 | 20,290 | 8,217 | 4,419 | 682 | 240,077 | 330.4 | 2,032.0 | +83.7% (includes 100k 12-15 cases) | +5.7% |
18-29 | 87,622 | 10,336 | 1,652 | 20,962 | 25,184 | 29,488 | 475.6 | 863.0 | +44.8% | -4.0% |
30-39 | 89,030 | 8,575 | 826 | 9,888 | 44,971 | 24,770 | 780.1 | 848.9 | +8.1% | -10.5% |
40-49 | 99,159 | 7,350 | 307 | 4,009 | 74,957 | 12,536 | 1,225.5 | 739.5 | -39.7% | -8.1% |
50-59 | 74,397 | 5,227 | 96 | 1,602 | 61,598 | 5,874 | 872.1 | 572.4 | -34.4% | -3.9% |
60-69 | 40,346 | 2,887 | 28 | 629 | 34,774 | 2,028 | 612.3 | 374.9 | -38.8% | -4.2% |
70-79 | 23,835 | 1,584 | 7 | 212 | 21,249 | 783 | 458.7 | 317.3 | -30.8% | -3.9% |
80+ | 11,415 | 988 | 4 | 212 | 9,765 | 446 | 380.1 | 352.5 | -7.3% | -3.1% |
Cases reported by specimen date between week 36 & 39 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1023849/Vaccine_surveillance_report_-_week_40.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 305,428 | 20,967 | 4,073 | 5,898 | 609 | 272,981 | 278.8 | 2,325.7 | +88.0% (includes 135k 12-15 cases) | +4.3% |
18-29 | 67,820 | 8,556 | 1,119 | 12,593 | 22,112 | 23,440 | 409.6 | 688.1 | +40.5% | -4.3% |
30-39 | 81,532 | 7,534 | 690 | 7,468 | 44,391 | 21,449 | 763.6 | 738.4 | -3.3% | -11.4% |
40-49 | 101,094 | 6,839 | 297 | 3,653 | 78,643 | 11,662 | 1,291.8 | 690.2 | -46.6% | -6.9% |
50-59 | 70,731 | 4,668 | 88 | 1,464 | 59,366 | 5,144 | 839.5 | 502.5 | -40.1% | -5.7% |
60-69 | 36,953 | 2,585 | 26 | 546 | 31,998 | 1,798 | 563.1 | 332.9 | -40.9% | -2.1% |
70-79 | 22,142 | 1,367 | 6 | 207 | 19,869 | 693 | 428.9 | 281.4 | -34.4% | -3.6% |
80+ | 10,581 | 863 | 4 | 199 | 9,106 | 403 | 354.4 | 319.5 | -9.8% | -2.5% |
Cases reported by specimen date between week 37 & 40 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1025358/Vaccine-surveillance-report-week-41.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 348,514 | 22,301 | 6,396 | 7,964 | 654 | 311,199 | 276.5 | 2,670.7 | +89.6% (includes 180k 12-15 cases) | +1.6% |
18-29 | 60,057 | 7,683 | 837 | 8,937 | 22,053 | 20,547 | 402.6 | 605.0 | +33.5% | -7.0% |
30-39 | 83,007 | 7,138 | 626 | 6,479 | 48,232 | 20,532 | 823.9 | 709.8 | -13.8% | -10.5% |
40-49 | 111,896 | 6,778 | 292 | 3,551 | 89,546 | 11,729 | 1,455.8 | 696.2 | -52.2% | -5.6% |
50-59 | 74,981 | 4,506 | 85 | 1,463 | 63,929 | 4,998 | 903.1 | 489.3 | -45.8% | -5.7% |
60-69 | 38,184 | 2,455 | 24 | 525 | 33,486 | 1,694 | 589.0 | 314.1 | -46.7% | -5.8% |
70-79 | 23,109 | 1,363 | 7 | 201 | 20,916 | 622 | 451.5 | 253.0 | -44.0% | -9.6% |
80+ | 10,770 | 839 | 7 | 184 | 9,365 | 375 | 364.6 | 298.5 | -18.1% | -8.3% |
Cases reported by specimen date between week 38 & 41 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1027511/Vaccine-surveillance-report-week-42.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 |
397,882 |
24,292 |
10,698 |
11,001 |
743 |
351,148 |
314.1 |
3,013.6 |
+89.6% (includes 230k 12-15 cases) | 0% |
18-29 |
62,885 |
7,512 |
758 |
8,404 |
25,309 |
20,902 |
462.1 |
615.4 |
+24.9% (615.4-462.1)/615.4 as % | -8.6% |
30-39 |
92,257 |
7,346 |
636 |
6,545 |
56,004 |
21,726 |
956.7 |
751.1 |
-21.5% (956.7-751.1)/956.7 as % | -7.7% |
40-49 |
130,904 |
7,297 |
293 |
3,800 |
106,492 |
13,022 |
1,731.3 |
772.9 |
-55.4% (1731.3-772.9)/1731.3 as % | -3.2% |
50-59 |
88,020 |
4,790 |
80 |
1,632 |
76,119 |
5,399 |
1,075.3 |
528.6 |
-50.8% (1075.3-528.6)/1075.3 as % | -5.0% |
60-69 |
45,155 |
2,614 |
24 |
617 |
40,028 |
1,872 |
704.1 |
347.1 |
-50.7% (704.1-347.1)/704.1 as % | -4.0% |
70-79 |
27,360 |
1,559 |
12 |
215 |
24,916 |
658 |
537.9 |
267.6 |
-50.3% (537.9-267.6)/537.9 as % | -6.3% |
80+ |
11,907 |
854 |
7 |
215 |
10,449 |
382 |
406.8 |
304.1 |
-25.2% (406.8-304.1)/406.8 as % | -7.1% |
Cases reported by specimen date between week 39 & 42 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1029606/Vaccine-surveillance-report-week-43.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 411,079 | 24,798 | 16,640 | 13,812 | 821 | 355,008 | 586.2 | 3,149.6 | +81.4% (includes 240k 12-15 cases) | -8.2% |
18-29 | 68,780 | 7,713 | 686 | 8,532 | 29,413 | 22,436 | 532.9 | 674.0 | +20.9% (674.0-532.9)/674.0 as % | -4.0% |
30-39 | 102,344 | 7,858 | 645 | 6,856 | 63,237 | 23,748 | 1,071.8 | 817.7 | -23.7% (1071.8-817.7)/1071.8 as % | -2.2% |
40-49 | 145,641 | 7,989 | 291 | 3,962 | 119,063 | 14,336 | 1,936.2 | 834.9 | -56.9% (1936.2-834.9)/1936.2 as % | -1.5% |
50-59 | 102,009 | 5,330 | 81 | 1,767 | 88,740 | 6,091 | 1,248.7 | 586.1 | -53.1% (1248.7-586.1)/1248.7 as % | -2.3% |
60-69 | 54,020 | 2,968 | 22 | 702 | 48,161 | 2,167 | 836.6 | 391.2 | -53.2% (836.6-391.2)/836.6 as % | -2.5% |
70-79 | 32,909 | 1,822 | 14 | 254 | 30,025 | 794 | 635.4 | 312.2 | -50.9% (635.4-312.2)/635.4 as % | -0.6% |
80+ | 13,231 | 936 | 7 | 219 | 11,635 | 434 | 432.5 | 333.8 | -22.8% (432.5-333.8)/432.5 as % | +2.4% |
Cases reported by specimen date between week 40 & 43 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1031157/Vaccine-surveillance-report-week-44.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 397,484 | 23,778 | 20,041 | 15,954 | 818 | 336,893 | 345.8 | 2,891.2 | +88.0% | +6.6% |
18-29 | 75,211 | 7,955 | 701 | 8,809 | 33,649 | 24,097 | 614.4 | 709.5 | +13.4% | -7.5% |
30-39 | 113,717 | 8,476 | 665 | 7,252 | 71,492 | 25,832 | 1,221.3 | 893.0 | -26.9% | -3.2% |
40-49 | 159,478 | 8,580 | 291 | 4,204 | 130,686 | 15,717 | 2,124.6 | 932.9 | -56.1% | +0.8% |
50-59 | 114,282 | 5,853 | 81 | 1,925 | 99,722 | 6,701 | 1,408.8 | 656.1 | -53.4% | -0.3% |
60-69 | 63,474 | 3,353 | 23 | 835 | 56,779 | 2,484 | 998.8 | 460.5 | -53.9% | -0.7% |
70-79 | 37,535 | 2,037 | 16 | 260 | 34,305 | 917 | 740.6 | 372.9 | -49.6% | +1.3% |
80+ | 14,043 | 1,002 | 7 | 224 | 12,339 | 471 | 480.3 | 374.9 | -21.9% | +0.9% |
Well would you look at that? The Daily Mail publishes an article revealing that...
1. UK statistics watchdog scolds PHE's replacement body for publishing 'misleading' figures which anti-vaxxers have seized as proof that Covid jabs don't work
2. The UK Health Security Agency (UKHSA) now publishes weekly surveillance reports, after taking over the reigns from the now-defunct Public Health England.
3. Over the past few weeks, the agency's data shows infection rates are higher in fully-vaccinated adults compared to the unjabbed.
4. Anti-vaxx commentators and campaigners have seized the data as proof that Covid vaccines don't work.
And now as, if by magic, the consistent pattern of the 7 weeks from week35 - week41, has miraculously slowed down and stopped altogether. Well Hallelujah - we are delivered from vaccine induced AIDS coincident with a scolding by the government of its statistics agency.
The UK's statistics watchdog has now waded into the issue, calling on the UKHSA to better explain some of the issues with the data. - https://www.dailymail.co.uk/health/article-10155799/Stats-watchdog-scolds-PHE-replacement-data-misuse-supports-anti-vaxxers.html
The UK's Statistics Watchdog is The Office of Statistics Regulation (TOSR for short). Yes Offstats has told the UKHSA that their Stats are off. And now they are nicely back on message. Nothing to see here folks. Now go get your gene therapy.
Cases reported by specimen date between week 41 & 44 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1032859/Vaccine_surveillance_report_-_week_45.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under 18 | 357,480 | 21,567 | 19,466 | 17,134 | 806 | 298,507 | 575.5 | 2,648.3 |
+78.3% |
-9.7% |
18-29 | 80,338 | 8,245 | 713 | 9,031 | 36,782 | 25,567 | 666.5 | 768.1 |
+13.2% |
-0.2% |
30-39 | 118,564 | 8,793 | 658 | 7,322 | 74,950 | 26,841 | 1,270.4 | 924.2 | -27.2% |
-0.3% |
40-49 | 158,906 | 8,666 | 269 | 4,130 | 129,821 | 16,020 | 2,111.1 | 933.0 | -55.8% |
+0.3% |
50-59 | 117,264 | 5,952 | 91 | 1,933 | 102,366 | 6,922 | 1,440.5 | 666.0 | -53.8% |
-0.4% |
60-69 | 67,392 | 3,484 | 33 | 878 | 60,351 | 2,646 | 1,048.4 | 477.7 | -54.4% |
-0.5% |
70-79 | 37,675 | 2,049 | 19 | 273 | 34,328 | 1,006 | 726.5 | 395.5 |
-45.6% |
+4.0% |
80+ | 13,218 | 912 | 6 | 198 | 11,588 | 514 | 430.8 | 395.4 | -8.2% |
+13.7% |
Since October 21 case numbers have been falling from 52,009 to 40,375 per day. But the UKHSA asks us to believe that unvaxxed case numbers are rising. That is simply not possible because every day more of them get natural immunity which does not wane and the total number of infected people is decreasing as is the total number of unvaccinated people.
Cases reported by specimen date between week 42 & 45 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1034383/Vaccine-surveillance-report-week-46.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 | 313,716 | 19,133 | 19,103 | 18,886 | 839 | 255,755 | 531.2 | 2,301.2 | +76.9% | -1.4% |
18-29 | 84,503 | 8,379 | 725 | 8,937 | 39,748 | 26,714 | 713.2 | 805.2 | +11.4% | -1.8% |
0-39 | 122,367 | 8,981 | 646 | 7,325 | 77,958 | 27,457 | 1,314.90 | 948.7 | -27.9% | -0.7% |
0-49 | 154,671 | 8,503 | 270 | 4,042 | 125,936 | 15,920 | 2,043.50 | 929.5 | -54.5% | +1.3% |
0-59 | 117,722 | 5,890 | 98 | 1,947 | 102,635 | 7,152 | 1,442.90 | 689.6 | -52.2% | +1.6% |
0-69 | 68,181 | 3,425 | 45 | 863 | 61,109 | 2,739 | 1,061.10 | 495.4 | -53.3% | +1.1% |
0-79 | 34,455 | 1,891 | 14 | 251 | 31,232 | 1,067 | 660.9 | 420.9 | -36.3% | +9.3% |
80+ | 11,863 | 838 | 11 | 176 | 10,298 | 540 | 383.2 | 417.9 | +8.3% | +16.5% |
Cases reported by specimen date between week 43 & 46 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1036047/Vaccine_surveillance_report_-_week_47.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 | 300,318 | 18,197 | 15,924 | 21,610 | 865 | 243,722 | 501.5 | 2,229.0 |
+77.5% |
+0.6% |
18-29 | 88,261 | 8,511 | 751 | 8,728 | 42,580 | 27,691 | 757.1 | 837.6 |
+9.6% |
-1.8% |
30-39 | 126,626 | 9,113 | 610 | 7,206 | 81,808 | 27,889 | 1,373.1 | 967.0 |
-29.6% |
-1.7% |
40-49 | 153,385 | 8,270 | 261 | 3,963 | 124,936 | 15,955 | 2,022.9 | 933.8 |
-53.8% |
+0.7% |
50-59 | 116,218 | 5,679 | 106 | 1,938 | 101,284 | 7,211 | 1,422.5 | 697.0 |
-51.0% |
+1.2% |
60-69 | 65,380 | 3,165 | 48 | 869 | 58,517 | 2,781 | 1,015.6 | 504.1 |
-50.4% |
+2.9% |
70-79 | 28,282 | 1,543 | 11 | 226 | 25,435 | 1,067 | 538.2 | 422.7 |
-21.5% |
+14.8% |
80+ | 9,979 | 669 | 15 | 162 | 8,606 | 527 | 320.7 | 410.0 |
+27.8% |
+19.5% |
Cases reported by specimen date between week 44 & 47 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1037987/Vaccine-surveillance-report-week-48.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 |
321,062 |
19,608 |
14,327 |
26,299 |
954 |
259,874 |
502.7 |
2,422.6 |
+79.2% | +1.7% |
18-29 |
92,077 |
8,975 |
752 |
8,604 |
45,181 |
28,565 |
794.3 |
868.6 |
+8.6% | -1.0% |
30-39 |
132,341 |
9,517 |
598 |
7,203 |
86,318 |
28,705 |
1,439.8 |
1,000.1 |
-30.5% | -0.9% |
40-49 |
153,958 |
8,386 |
254 |
3,830 |
125,524 |
15,964 |
2,026.6 |
937.5 |
-53.7% | +0.1% |
50-59 |
115,113 |
5,584 |
122 |
1,908 |
100,164 |
7,335 |
1,404.8 |
711.2 |
-49.4% | +1.6% |
60-69 |
60,417 |
2,905 |
47 |
796 |
53,818 |
2,851 |
933.3 |
518.3 |
-44.5% | +5.9% |
70-79 |
21,911 |
1,306 |
11 |
205 |
19,330 |
1,059 |
409.0 |
421.6 |
+3.0% | +24.5% |
80+ |
8,388 |
555 |
18 |
141 |
7,115 |
559 |
265.5 |
437.3 |
+39.3% | +11.5% |
Cases reported by specimen date between week 45 & 48 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1039677/Vaccine_surveillance_report_-_week_49.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 |
368,450 |
22,416 |
14,218 |
33,326 |
1,140 |
297,350 |
549.7 |
2,795.7 |
+80.3% | +1.1% |
18-29 |
103,160 |
10,039 |
784 |
9,133 |
52,000 |
31,204 |
906.3 |
952.6 |
+4.9% | -3.7% |
30-39 |
148,591 |
10,694 |
674 |
7,775 |
98,211 |
31,237 |
1,629.7 |
1,092.8 |
-32.9% | -2.4% |
40-49 |
172,297 |
9,122 |
299 |
4,130 |
141,195 |
17,551 |
2,273.6 |
1,034.0 |
-54.5% | -0.8% |
50-59 |
121,940 |
5,853 |
127 |
2,049 |
105,883 |
8,028 |
1,482.4 |
780.9 |
-47.3% | +2.1% |
60-69 |
57,170 |
2,953 |
56 |
845 |
50,279 |
3,037 |
870.9 |
554.1 |
-36.4% | +8.1% |
70-79 |
17,816 |
1,166 |
12 |
209 |
15,326 |
1,103 |
324.1 |
441.3 |
+26.6% | +23.6% |
80+ |
7,898 |
592 |
16 |
133 |
6,571 |
586 |
245.4 |
461.0 |
+46.8% | +7.5% |
Cases reported by specimen date between week 46 & 49 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1041593/Vaccine-surveillance-report-week-50.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 |
388,357 |
23,947 |
11,724 |
1,312 |
38,380 |
312,994 |
503.9 |
2,960.4 |
+83.0% | +2.7% |
18-29 |
133,101 |
13,147 |
982 |
71,710 |
10,529 |
36,733 |
1,240.2 |
1,126.0 |
-9.2% | -14.1% |
30-39 |
173,537 |
12,671 |
745 |
116,570 |
8,613 |
34,938 |
1,925.7 |
1,227.0 |
-36.3% | -3.4% |
40-49 |
189,245 |
10,177 |
352 |
155,047 |
4,438 |
19,231 |
2,491.0 |
1,136.6 |
-54.4% | +0.1% |
50-59 |
125,434 |
6,149 |
149 |
108,334 |
2,141 |
8,661 |
1,514.0 |
844.9 |
-44.2% | +3.1% |
60-69 |
53,006 |
2,966 |
59 |
45,846 |
876 |
3,259 |
793.0 |
596.4 |
-24.8% | +11.6% |
70-79 |
15,742 |
1,099 |
13 |
13,246 |
232 |
1,152 |
280.1 |
463.1 |
+39.5% | +12.9% |
≥80 |
7,661 |
570 |
14 |
6,308 |
131 |
638 |
235.9 |
505.0 |
+53.3% | +6.5% |
Cases reported by specimen date between week 47 & 50 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1043608/Vaccine_surveillance_report_-_week_51.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Weekly Decline |
Under18 |
395,335 |
25,523 |
8,990 |
46,126 |
2,168 |
312,528 |
635.5 |
2,973.9 |
+78.6% | -4.4% |
18-29 |
257,526 |
23,829 |
1,693 |
16,198 |
163,814 |
51,992 |
2,809.1 |
1,603.5 |
-42.9% | -33.7% |
30-39 |
254,435 |
18,013 |
1,112 |
10,911 |
181,600 |
42,799 |
2,985.1 |
1,510.3 |
-49.4% | -13.1% |
40-49 |
230,670 |
12,518 |
471 |
5,117 |
190,320 |
22,244 |
3,049.9 |
1,320.1 |
-56.7% | -2.3% |
50-59 |
147,033 |
7,548 |
203 |
2,425 |
126,812 |
10,045 |
1,768.9 |
983.7 |
-44.4% | -0.2% |
60-69 |
58,233 |
3,449 |
91 |
948 |
49,998 |
3,747 |
863.5 |
688.4 |
-20.3% | +4.5% |
70-79 |
18,858 |
1,327 |
27 |
246 |
15,990 |
1,268 |
338.2 |
512.6 |
+34.0% | -5.5% |
80+ |
9,067 |
695 |
16 |
160 |
7,482 |
714 |
280.3 |
568.5 |
+50.7% | -2.6% |
Cases reported by specimen date between week 49 & 52 2021 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1045329/Vaccine_surveillance_report_week_1_2022.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated Cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
14 day Decline |
Under 18 |
429,155 |
32,145 |
7,104 |
72,620 |
9,103 |
308,183 |
1,827.4 |
2,961.6 |
+38.3% | -40.3% |
18-29 |
628,127 |
52,666 |
5,532 |
36,594 |
430,387 |
102,948 |
7,221.4 |
3,240.8 |
-55.1% | -12.2% |
30-39 |
529,948 |
38,026 |
2,973 |
20,676 |
393,216 |
75,057 |
6,383.9 |
2,686.6 |
-57.9% | -8.5% |
40-49 |
408,892 |
24,189 |
1,206 |
9,075 |
338,664 |
35,758 |
5,393.8 |
2,147.2 |
-60.2% | -3.5% |
50-59 |
308,585 |
17,250 |
568 |
4,430 |
268,952 |
17,385 |
3,738.4 |
1,721.9 |
-53.9% | -9.5% |
60-69 |
148,836 |
8,902 |
313 |
1,659 |
131,543 |
6,419 |
2,266.3 |
1,194.3 |
-47.3% | -27% |
70-79 |
70,723 |
4,297 |
116 |
515 |
63,697 |
2,098 |
1,347.6 |
862.0 |
-36.0% | -70.0% |
80+ |
32,314 |
2,589 |
50 |
395 |
28,066 |
1,214 |
1,055.0 |
981.5 |
-7.0% | -57.7% |
Cases reported by specimen date between week 50 2021 & Week1 2022 - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1046431/Vaccine-surveillance-report-week-2-2022.pdf
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated Cases |
Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
7 day Decline |
Under18 |
501,913 |
39,487 |
7,711 |
90,854 |
15,430 |
348,431 |
2,356.6 |
3,376.1 |
+30.2% | -8.1% |
18to29 |
785,297 |
65,993 |
7,161 |
45,408 |
540,309 |
126,426 |
8,926.0 |
4,058.9 |
-54.5% | +0.6% |
30to39 |
639,522 |
47,573 |
3,738 |
24,845 |
473,155 |
90,211 |
7,618.8 |
3,268.8 |
-57.1% | +0.8% |
40to49 |
484,912 |
30,460 |
1,480 |
11,162 |
399,165 |
42,645 |
6,330.1 |
2,585.9 |
-59.1% | +0.9% |
50to59 |
396,008 |
22,864 |
716 |
5,471 |
345,773 |
21,184 |
4,796.2 |
2,117.0 |
-55.9% | -2.0% |
60to69 |
202,505 |
12,150 |
383 |
1,984 |
180,116 |
7,872 |
3,099.9 |
1,477.9 |
-52.3% | -5.0% |
70to79 |
100,553 |
6,161 |
147 |
667 |
91,024 |
2,554 |
1,926.2 |
1,059.6 |
-45.0% | -9.0% |
80+ |
50,548 |
4,413 |
61 |
548 |
43,980 |
1,546 |
1,657.7 |
1,262.9 |
-23.8% | -16.8% |
18+ |
2,659,345 | 189,614 | 13,686 | 90,085 | 2,073,522 | 292,438 | 4,907.8 | 2,261.6 | -49.7% | -4.4% |
1. Over 7x more covid19 cases in the double vaxxed than in the unvaxxed
2. Over 2 million fully vaccinated Covid-19 cases in one week. There is an effective vaccination for you.
3. Fully vaccinated people are precisely twice as likely to catch Covid as unvaccinated people.
Age group | Vaccine Efficacy Dec31 |
Vaccine Efficacy Jan14 |
Vaccine Efficacy Jan28 |
Vaccine Efficacy Feb11 |
Vaccine Efficacy Feb25 |
14 day Decline |
Under 18 |
+38.3% |
-2.0% |
-42.3% |
-82.6% |
-100.0% |
-40.3% |
18-29 |
-55.1% |
-67.3% |
-79.5% |
-91.7% |
-100.0% |
-12.2% |
30-39 |
-57.9% |
-66.4% |
-74.9% |
-83.4% |
-91.9% |
-8.5% |
40-49 |
-60.2% |
-63.7% |
-67.2% |
-70.7% |
-74.2% |
-3.5% |
50-59 |
-53.9% |
-63.4% |
-72.9% |
-82.4% |
-91.9% |
-9.5% |
60-69 |
-47.3% |
-74.3% |
-100.0% |
-100.0% |
-100.0% |
-27.0% |
70-79 |
-36.0% |
-100.0% |
-100.0% |
-100.0% |
-100.0% |
-70.0% |
80+ |
-7.0% |
-64.7% |
-100.0% |
-100.0% |
-100.0% |
-57.7% |
Choosing your formula...
Age group | Rates
per 100k in double vaxxed (V) |
Rates per 100k in unvaxxed (U) |
Immune system boost or
degradation % (U-V)/U when positive (pfizer's formula) (U-V)/V when negative |
Vaccine efficacy % for double vaxxed compared to unvaxxed (U-V)/U (Pfizer's formula) |
Under 18 |
586.2 | 3,149.6 | +81.4% (includes 240k 12-15 cases) | +81.4% (includes 240k 12-15 cases) |
18-29 |
532.9 | 674.0 | +20.9% (674.0-532.9)/674.0 as % | +20.9% (674.0-532.9)/674.0 as % |
30-39 |
1,071.8 | 817.7 | -23.7% (1071.8-817.7)/1071.8 as % | -31.1% (1071.8-817.7)/817.7 as % |
40-49 |
1,936.2 | 834.9 | -56.9% (1936.2-834.9)/1936.2 as % | -131.9% (1936.2-834.9)/834.9 as % |
50-59 |
1,248.7 | 586.1 | -53.1% (1248.7-586.1)/1248.7 as % | -113.1% (1248.7-586.1)/586.1 as % |
60-69 |
836.6 | 391.2 | -53.2% (836.6-391.2)/836.6 as % | -113.9% (836.6-391.2)/391.2 as % |
70-79 |
635.4 | 312.2 | -50.9% (635.4-312.2)/635.4 as % | -103.5% (635.4-312.2)/312.2 as % |
80+ |
432.5 | 333.8 | -22.8% (432.5-333.8)/432.5 as % | -29.6% (432.5-333.8)/333.8 as % |
The Immune System boost/degradation column is a measure of the boost or damage to your immune system - see report
The Vaccine Efficacy % for double vaxxed column shows how much more or less resistant to Covid the double vaxxed are than the unvaxxed - see report
So if you are 40 years old and double vaxxed then your immune response is now degraded by 56.9%.
This means that unvaxxed 40 year olds are 56.9% less likely to catch covid than the doubly vaxxed
And the doubly vaxxed 40 year olds are 131.9% more likely to catch covid than the unvaxxed.
You can look at it either way. It just depends whether your chosen parameter is the doubly vaccinated or the unvaccinated. But whichever one you choose, the outlook this winter for those who have been fully vaccinated with the experimental Covid-19 injections looks terrible.
Reese Report Video - https://banned.video/watch?id=61703cfd6978e80911d833df
___________
Pfizer originally claimed a 95% efficiency for their vaccine (calculated with the formula used in the immune boost or degradation column above). The figures above indicate that, their figures may well have been correct immediately after vaccination (the younger age groups have had the vaccine for the shortest time). But the figures above also show that the vaccines do NOT merely lose efficiency over time down to zero efficiency. They progressively damage the immune system until a negative efficiency is realised. They presently leave anybody over 30 in a worse position than they were before vaccination.
PHE figures show that vaccines now suppress your immune response to Covid rather than boosting it. The measure of that suppression is the ratio of normalised vaxxed vs unvaxxed case numbers. This is what Pfizer used in the first place and nobody argued with it then. What is causing this reversal of a magnitude which is increasing week on week? It is quite obviously a deterioration in immune capability in the vaxxed when compared to the unvaxxed. And it is getting more and more pronounced every week. That is a form of Vaccine Acquired Immune Deficiency. The immune systems of the vaxxed are deficient when compared immune systems of the unvaxxed. That means one of two things. Either the unvaxxed are getting better and better immune systems for no reason having had no intervention. Or the vaxxed are getting worse and worse immune systems due to the intervention they have had, which intervention was the vaccine. For more see - https://theexpose.uk/2021/10/15/latest-data-shows-covid-vaccines-have-negative-effectiveness-minus-109-percent/
https://www.infowars.com/posts/major-government-report-proves-covid-vaccines-are-bioweapons-video/
If the case numbers of the vaxxed converged and met up with the case numbers of the unvaxxed then the vaccine would have merely lost its effectiveness and the tables would all be grean and the vaccine efficiency would be ZERO. But that did not happen. The vaxxed case numbers are now twice the unvaxxed case numbers per 100k people. So the tables have all gone red. That means the vaccines have not merely lost their efficiency. They have not merely stopped working. They are still very much working. But they are working against your immune system rather than for it. They are suppressing your immune response. They are damaging your immune system. They are causing it for be worse than if you have not taken the vaccine. They are toxic to your immune system. They are not merely ineffective. They are negatively effective. All you will get from PHE is the following...
"In individuals aged greater than 30, the rate of positive COVID-19 test is higher in vaccinated individuals compared to unvaccinated". - PHE Vaccine Surveillance Report for week 41.
They deliberately fail to articulate the inevitable immunological conclusion from that statement, which is that the case rate being higher in the vaxxed means that the immune system is lower in the vaxxed, which means that the vaccines are damaging the immune response, which means that the vaccines are damaging your immune system, which means that the vaccines are making your immune system deficient, which means that the vaccines are giving you vaccine mediated immune deficiency, which means that the vaccines are giving you a form of AIDS (Acquired Immune Deficiency Syndrome).
PHE death rates verses ONS death rates
There is a massive immunological contradiction between the case rates which crudely speaking now show that vaxxed are twice as likely to be infected as unvaxxed whereas the death rates show that the unvaxxed as 3x to 6x more likely to die than the vaxxed.
The contradiction arises because the immunological functionality of the vaccines is merely to increase or decrease the viral load. And Fauci revealed in July that the viral loads were the same in the vaxxed as in the unvaxxed
“What we learned that’s new … is that when you look at the level of virus in the nasopharynx of people who are vaccinated who get breakthrough infections, it’s really quite high and equivalent to the level of virus in the nasopharynx of unvaccinated people who get infected,” Fauci said in an interview with CBS News’ “Face the Nation” on Sunday. The nasopharynx is part of the nasal cavity near the back of the throat https://www.theepochtimes.com/fauci-amount-of-covid-19-in-breakthrough-delta-cases-almost-identical-to-unvaccinated_3929532.html
Furthermore it is known that the vaccines have been becoming progressively less effective/more damaging since then. So what is happening with case numbers should also be occurring with deaths unless the vaccines only kick in at near lethal viral loads. But that is nonsense because they merely train the immune system to recognise a new antigen. They should be altering the manner in which it responds upon recognition. Vaccines do not do that.
Although of course these gene therapies are a lot more than vaccines. So from Fauci's own mouth the deaths should be following the case numbers not going in the other direction. Fortunately the ONS (Office of National Statistics) produce overall mortality figures and Profs Norman Fenton and Martin Neil of Queen Mary College University of London have analysed these as follows...
Week 26 was 2021June28-July4. Below is the mortality rate for those with 2 jabs for the first half of 2021..
Since 19 March the double dose vaccination mortality rate has increased week-on-week more or less consistently. - Prof Norman Fenton - https://www.normanfenton.com/post/comparing-age-adjusted-all-cause-mortality-rates-in-england-between-vaccinated-and-unvaccinated
So the ONS death rates as analysed by Prof Fenton are consistent with the PHE case rates as analysed in the article. The PHE death rates are not credible. So the ONS death rates show the same linear increase as the PHE case numbers are showing. That makes a lot more sense immunologically.
This article has been published by the Expose - https://theexpose.uk/2021/10/30/gov-reports-show-fully-vaccinated-and-children-developing-ade/
The Daily Mail published an article describing the anger that the government has with the UKHSA (formerly known as PHE) for publishing such revealing figures - which we used to demonstrate that the vaccines cause a form of AIDS. How dare they truthfully inform the British public about anything !
https://www.dailymail.co.uk/health/article-10155799/Stats-watchdog-scolds-PHE-replacement-data-misuse-supports-anti-vaxxers.html
Shingles skin blotches could well be the ulcers of Revelation16...
1 And I heard a loud voice out of the sanctuary say to the 7 angels: Go and pour out the 7 bowls of the anger of God into the earth.
2 And the first one went off and poured out his bowl into the earth. And a hurtful and malignant ulcer came to be upon the men that had the mark of the wild beast and that were worshiping its image. (Revelation 16 NWT)
THE FIX. We know that DNA – adenovirus vaccines (Astra Zeneca and Johnson & Johnson) install spike protein DNA cell nuclei which will continue to code for spike proteins until the cell dies. We know the mRNA lipid nanoparticle vaccines produce the same long term results (in particular that antibody production from the spikes of a 2nd jab at 12 weeks is 3.5-4.0 times the production for a 2nd jab at 4 weeks in both cases). So we can deduce that both vaccines induce infected cells to continue to produce spikes indefinitely until cell death and that the immune system therefore has to produce antibodies indefinitely. This puts the immune system into an infinite loop wherein vaccinated cells are churning out spikes and the immune system is killing those spikes. This goundhog day situation may be what is slowly weakening the immune systems of those who are vaccinated. The fix is to stop vaccinated cells producing spikes. We do know how to do that. We just have to treat each doubly vaxxed person as if they have long Covid, and continue to administer Vitamin C, Vitamin D, Zinc, Quercetin (or other Zinc cell door opener) and Ivermectin. We will be doing this not to cure people from a Covid-19 virus infection. But rather to cure them from the incessant Covid virus spike production by vaccinated cells.
Concise posting format for first version of this
Here is what PHE knows that is in the public domain in Vaccine Surveillance Reports for weeks 36-40
Here is the immune system degradation of doubly vaxxed per week over the last 4 weeks and the 4 week average.
Age and Week36 and Week37and Week38 and Week39 Average
18-29 and -2.5% and -1.9% and -4.0%
and -4.3% and -3.2%
30-39 and -6.0% and -7.0% and -10.5%
and -11.4% and -8.7%
40-49 and -5.2% and -5.3% and -8.1% and -6.9% and -6.4%
50-59 and -4.0% and -2.4% and -3.9% and -5.7% and -4.0%
60-69 and -4.2% and -2.9% and -4.2% and -2.1% and -3.35%
70-79 and -4.1% and +0.7% and -3.9% and -3.6% and -2.7%
80+ and -5.6% and -7.1% and -3.1% and -2.5% and -4.6%
Age Current% weekly decline weeks until 100% immune system degradation of doubly vaxxed
18-29 and +40.5% and -3.2% and 44 weeks (140.5 over 3.2)
30-39 and -3.3% and -8.7% and 12 weeks (96.7 over 8.7)
40-49 and -46.6% and -6.4% and 9 weeks (53.4 over 6.4)
50-59 and -40.1% and -4.0% and 15 weeks (59.9 over 4.0)
60-69 and -40.9% and -3.35% and 18 weeks (59.1 over 3.35)
70-79 and -34.4% and -2.7% and 25 weeks (65.6 over 2.7)
90+ and -9.8% and -4.6% and 20 weeks (90.2 over 4.6)
These are the % degradation and weekly decreases of immune response of doubly vaxxed compared to unvaxxed over the last 4 weeks calculated from the Vaccine Surveillance Reports 36-40 using Pfizer's own formula for vaccine effectiveness
Presently everyone over 30 is between 3.3% and 46.6% better off being unvaxxed. But that is not the problem. The trouble is the rate of loss of immune response in the doubly vaxxed is so large and so consistent every week (between 2.7% and 8.7%) that by Christmas everyone between 30 and 50 will have 100% immune system degradation and by March everyone over 50 will have 100% immune system degration and the children will follow them 9 months later (since they were vaccinated later).
https://www.gov.uk/government/publications/covid-19-vaccine-weekly-surveillance-reports
https://www.gov.uk/government/publications/covid-19-vaccine-surveillance-report
Full exposition with all PHE data www.truebiblecode.com/understanding917.html
This has been sent to every MP in the country and as many immunologists as I could find
“When you look at this, the biggest thing that you see is you see everything is doing really well,” Thompson said, reviewing the patient’s pre-jab panel.
However, the second panel, taken after the patient’s first coronavirus vaccine, showed an interesting difference.
“Here’s what’s interesting. As you see the CD8 cells started to jump way up,” Thompson observed.
“CD8 cell is called a suppressor T cell. It’s also known as a killer T cell. What do killer T cells actually do? Well…these are sniper specific cells and they are designed to kill virally infected cells…that are literally wearing the virus on the surface of the cell – think of spike protein – and it’s also killing cancer cells. That’s the job. They’re very sniper specific,” he explained.
“So when you look at this, you can see those CD8 cells after the first you-know-what, you can see they start to jump up. They’re saying, ‘Hold the phone. What is going on here? We need to start killing off these cells that are expressing a specific… I don’t know how you say, spike protein,'” Thompson clarified.
The third panel, administered after the patient’s second mRNA jab, showed an even more startling development, as the patient’s adaptive immune system now appeared to have “tanked.”
“So, now what you see is you see that his granulocytes, look at how much they jumped up,” Thompson said, gasping, “Holy cow.”
“These granulocytes… basically they’re neutrophils, they’re first responders, they’re emergency type cells,” Thompson explained, “but they’re mostly for bacterial infection and they also clean up tissue damage.”
“When you look at his lymphocytes, so his lymphocytes are things like his CD4 cells, CD8 cells, natural killer cells, his b lymphocytes that are producing antibodies…you can see how badly now that’s started to tank. And then what’s interesting too is that you can see that his natural killer cells have absolutely tanked as well.”
- https://banned.video/watch?id=615ce5b9eb8423302e4f0d87
The result is lowered immunity for the patient, Thompson affirmed, which would leave a person susceptible to infection – even from cancer cells.
“Natural killer cells…this is part of your innate immune system. Okay? This is your innate immune system and natural killer cells are your first responders to things like viruses, virally infected cells, and yes, even cancer cells. And wow, holy cow. You can see how that is tanked.”
“So what has tanked?” Thompson asked. “His adaptive immune system has absolutely tanked. Adaptive immune system, CD4, CD8, natural killer cells, his b lymphocytes – all of those things have actually just gotten pummelled within the month.”
https://www.infowars.com/posts/my-jaw-dropped-blood-tests-before-after-covid-jab-prove-shot-obliterates-immune-system-doctor-claims/
The data can be downloaded from the ONS in Excel format
We use the data from...
Table 4: Weekly age-standardised mortality rates by vaccination status for deaths involving COVID-19, per 100,000 people, England, deaths occurring between 2 January 2021 and 2 July 2021
Table 5: Weekly age-standardised mortality rates by vaccination status for non COVID-19 deaths, per 100,000 people, England, deaths occurring between 2 January 2021 and 2 July 2021
Unvaccinated Deaths |
Unvaxxed Population |
Doubly Vaccinated Deaths |
Covid-Deaths per 100k |
Vaccine Efficacy |
All Deaths |
Vaccine Efficacy |
Death Factor |
|||||||||
Friday | Week | Covid | Non-Covid | All |
10+ |
Covid | Non-Covid | All |
Vaxxed |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
V/U |
08-Jan-21 | 1 | 4,788 | 7,412 | 12,200 | 37,803,666 | 1 | 17 | 18 | 267,629 | 12.67 | 0.37 | 97.05% | 32.27 | 6.73 | 79.16% | 0.21 |
15-Jan-21 | 2 | 6,089 | 6,900 | 12,989 | 36,511,424 | 14 | 87 | 101 | 399,963 | 16.68 | 3.50 | 79.01% | 35.58 | 25.25 | 29.02% | 0.71 |
22-Jan-21 | 3 | 6,563 | 6,049 | 12,612 | 34,737,408 | 25 | 141 | 166 | 406,528 | 18.89 | 6.15 | 67.45% | 36.31 | 40.83 | -11.09% | 1.12 |
29-Jan-21 | 4 | 5,164 | 4,945 | 10,109 | 32,897,999 | 25 | 139 | 164 | 411,079 | 15.70 | 6.08 | 61.26% | 30.73 | 39.90 | -22.98% | 1.30 |
05-Feb-21 | 5 | 3,520 | 4,100 | 7,620 | 31,004,385 | 17 | 184 | 201 | 421,167 | 11.35 | 4.04 | 64.45% | 24.58 | 47.72 | -48.50% | 1.94 |
12-Feb-21 | 6 | 2,419 | 3,401 | 5,820 | 28,941,393 | 17 | 202 | 219 | 435,150 | 8.36 | 3.91 | 53.26% | 20.11 | 50.33 | -60.04% | 2.50 |
19-Feb-21 | 7 | 1,625 | 2,998 | 4,623 | 27,025,851 | 25 | 206 | 231 | 452,826 | 6.01 | 5.52 | 8.18% | 17.11 | 51.01 | -66.47% | 2.98 |
26-Feb-21 | 8 | 997 | 2,198 | 3,195 | 25,261,345 | 6 | 235 | 241 | 510,095 | 3.95 | 1.18 | 70.20% | 12.65 | 47.25 | -73.23% | 3.74 |
05-Mar-21 | 9 | 654 | 1,839 | 2,493 | 23,795,540 | 8 | 257 | 265 | 676,798 | 2.75 | 1.18 | 56.99% | 10.48 | 39.15 | -73.24% | 3.74 |
12-Mar-21 | 10 | 389 | 1,620 | 2,009 | 22,496,119 | 21 | 342 | 363 | 944,609 | 1.73 | 2.22 | -22.22% | 8.93 | 38.43 | -76.76% | 4.30 |
19-Mar-21 | 11 | 237 | 1,372 | 1,609 | 20,222,106 | 9 | 470 | 479 | 1,333,720 | 1.17 | 0.67 | 42.42% | 7.96 | 35.91 | -77.85% | 4.51 |
26-Mar-21 | 12 | 166 | 1,183 | 1,349 | 18,316,034 | 17 | 711 | 728 | 2,183,425 | 0.91 | 0.78 | 14.09% | 7.37 | 33.34 | -77.91% | 4.53 |
02-Apr-21 | 13 | 90 | 1,025 | 1,115 | 17,224,336 | 20 | 1,165 | 1,185 | 3,792,492 | 0.52 | 0.53 | -0.92% | 6.47 | 31.25 | -79.28% | 4.83 |
09-Apr-21 | 14 | 84 | 919 | 1,003 | 16,960,669 | 27 | 1,685 | 1,712 | 5,434,251 | 0.50 | 0.50 | -0.32% | 5.91 | 31.50 | -81.23% | 5.33 |
16-Apr-21 | 15 | 54 | 874 | 928 | 16,544,821 | 26 | 2,273 | 2,299 | 7,284,379 | 0.33 | 0.36 | -8.56% | 5.61 | 31.56 | -82.23% | 5.63 |
23-Apr-21 | 16 | 46 | 795 | 841 | 15,927,073 | 14 | 2,946 | 2,960 | 9,213,443 | 0.29 | 0.15 | 47.39% | 5.28 | 32.13 | -83.56% | 6.08 |
30-Apr-21 | 17 | 34 | 708 | 742 | 15,509,284 | 24 | 3,394 | 3,418 | 10,867,328 | 0.22 | 0.22 | -0.73% | 4.78 | 31.45 | -84.79% | 6.57 |
07-May-21 | 18 | 20 | 603 | 623 | 15,030,867 | 28 | 4,137 | 4,165 | 12,528,914 | 0.13 | 0.22 | -40.46% | 4.14 | 33.24 | -87.53% | 8.02 |
14-May-21 | 19 | 19 | 578 | 597 | 14,401,995 | 18 | 4,626 | 4,644 | 14,347,609 | 0.13 | 0.13 | 4.90% | 4.15 | 32.37 | -87.19% | 7.81 |
21-May-21 | 20 | 17 | 600 | 617 | 13,574,870 | 17 | 4,946 | 4,963 | 16,025,854 | 0.13 | 0.11 | 15.29% | 4.55 | 30.97 | -85.32% | 6.81 |
28-May-21 | 21 | 14 | 475 | 489 | 12,851,588 | 23 | 5,034 | 5,057 | 18,037,385 | 0.11 | 0.13 | -14.57% | 3.80 | 28.04 | -86.43% | 7.37 |
04-Jun-21 | 22 | 18 | 502 | 520 | 12,356,247 | 27 | 5,325 | 5,352 | 19,575,469 | 0.15 | 0.14 | 5.32% | 4.21 | 27.34 | -84.61% | 6.50 |
11-Jun-21 | 23 | 20 | 430 | 450 | 11,757,509 | 29 | 5,408 | 5,437 | 21,059,770 | 0.17 | 0.14 | 19.05% | 3.83 | 25.82 | -85.18% | 6.75 |
18-Jun-21 | 24 | 13 | 448 | 461 | 10,970,992 | 29 | 5,510 | 5,539 | 22,035,117 | 0.12 | 0.13 | -9.96% | 4.20 | 25.14 | -83.28% | 5.98 |
25-Jun-21 | 25 | 26 | 434 | 460 | 10,125,621 | 48 | 5,538 | 5,586 | 22,669,600 | 0.26 | 0.21 | 17.54% | 4.54 | 24.64 | -81.56% | 5.42 |
02-Jul-21 | 26 | 35 | 401 | 436 | 9,531,364 | 63 | 5,881 | 5,944 | 23,309,568 | 0.37 | 0.27 | 26.40% | 4.57 | 25.50 | -82.06% | 5.57 |
1 | 2 | 3 | 4 | 5 | 6 | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 |
Here we remove 10-17 year olds from the unvaxxed population in the original ONS data to the number of 3.941 million to arrive at an approximation for the unvaxxed over 18s.
Unvaccinated Deaths |
Unvaxxed Population |
Unvaxxed Population |
Doubly Vaccinated Deaths |
Covid-Deaths per 100k |
Vaccine Efficacy |
All Deaths |
Vaccine Efficacy |
Death Factor |
|||||||||
Friday | Week | Covid | Non-Covid | All |
18+ |
10+ |
Covid | Non-Covid | All |
Vaxxed |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
V/U |
8-Jan-21 | 1 | 4,795 | 7,473 | 12,268 | 33,859,436 | 37,800,436 | 1 | 17 | 18 | 268,036 | 14.16 | 0.37 | 97.37% | 36.23 | 6.72 | 81.47% | 0.19 |
15-Jan-21 | 2 | 6,101 | 6,951 | 13,052 | 32,565,913 | 36,506,913 | 14 | 87 | 101 | 400,616 | 18.73 | 3.49 | 81.35% | 40.08 | 25.21 | 37.10% | 0.63 |
22-Jan-21 | 3 | 6,580 | 6,116 | 12,696 | 30,790,280 | 34,731,280 | 25 | 141 | 166 | 407,220 | 21.37 | 6.14 | 71.27% | 41.23 | 40.76 | 1.14% | 0.99 |
29-Jan-21 | 4 | 5,177 | 5,004 | 10,181 | 28,949,454 | 32,890,454 | 25 | 140 | 165 | 411,789 | 17.88 | 6.07 | 66.05% | 35.17 | 40.07 | -12.23% | 1.14 |
5-Feb-21 | 5 | 3,532 | 4,162 | 7,694 | 27,054,358 | 30,995,358 | 18 | 185 | 203 | 421,913 | 13.06 | 4.27 | 67.32% | 28.44 | 48.11 | -40.89% | 1.69 |
12-Feb-21 | 6 | 2,430 | 3,460 | 5,890 | 24,990,537 | 28,931,537 | 17 | 204 | 221 | 435,907 | 9.72 | 3.90 | 59.89% | 23.57 | 50.70 | -53.51% | 2.15 |
19-Feb-21 | 7 | 1,635 | 3,048 | 4,683 | 23,074,114 | 27,015,114 | 25 | 208 | 233 | 453,654 | 7.09 | 5.51 | 22.23% | 20.30 | 51.36 | -60.48% | 2.53 |
26-Feb-21 | 8 | 1,002 | 2,252 | 3,254 | 21,308,745 | 25,249,745 | 6 | 237 | 243 | 511,111 | 4.70 | 1.17 | 75.04% | 15.27 | 47.54 | -67.88% | 3.11 |
5-Mar-21 | 9 | 659 | 1,893 | 2,552 | 19,842,542 | 23,783,542 | 8 | 260 | 268 | 678,100 | 3.32 | 1.18 | 64.48% | 12.86 | 39.52 | -67.46% | 3.07 |
12-Mar-21 | 10 | 391 | 1,668 | 2,059 | 18,542,857 | 22,483,857 | 21 | 344 | 365 | 946,296 | 2.11 | 2.22 | -4.98% | 11.10 | 38.57 | -71.21% | 3.47 |
19-Mar-21 | 11 | 239 | 1,412 | 1,651 | 16,268,392 | 20,209,392 | 9 | 475 | 484 | 1,336,055 | 1.47 | 0.67 | 54.15% | 10.15 | 36.23 | -71.99% | 3.57 |
26-Mar-21 | 12 | 166 | 1,234 | 1,400 | 14,361,925 | 18,302,925 | 17 | 715 | 732 | 2,187,083 | 1.16 | 0.78 | 32.75% | 9.75 | 33.47 | -70.87% | 3.43 |
2-Apr-21 | 13 | 91 | 1,069 | 1,160 | 13,270,388 | 17,211,388 | 21 | 1,182 | 1,203 | 3,797,754 | 0.69 | 0.55 | 19.36% | 8.74 | 31.68 | -72.40% | 3.62 |
9-Apr-21 | 14 | 84 | 962 | 1,046 | 13,007,223 | 16,948,223 | 27 | 1,707 | 1,734 | 5,440,741 | 0.65 | 0.50 | 23.16% | 8.04 | 31.87 | -74.77% | 3.96 |
16-Apr-21 | 15 | 54 | 919 | 973 | 12,591,798 | 16,532,798 | 26 | 2,303 | 2,329 | 7,292,362 | 0.43 | 0.36 | 16.86% | 7.73 | 31.94 | -75.81% | 4.13 |
23-Apr-21 | 16 | 46 | 826 | 872 | 11,974,059 | 15,915,059 | 14 | 2,977 | 2,991 | 9,222,983 | 0.38 | 0.15 | 60.49% | 7.28 | 32.43 | -77.54% | 4.45 |
30-Apr-21 | 17 | 35 | 745 | 780 | 11,555,943 | 15,496,943 | 24 | 3,436 | 3,460 | 10,878,526 | 0.30 | 0.22 | 27.16% | 6.75 | 31.81 | -78.78% | 4.71 |
7-May-21 | 18 | 20 | 641 | 661 | 11,077,474 | 15,018,474 | 28 | 4,218 | 4,246 | 12,540,951 | 0.18 | 0.22 | -19.13% | 5.97 | 33.86 | -82.38% | 5.67 |
14-May-21 | 19 | 20 | 611 | 631 | 10,448,366 | 14,389,366 | 19 | 4,706 | 4,725 | 14,361,121 | 0.19 | 0.13 | 30.88% | 6.04 | 32.90 | -81.64% | 5.45 |
21-May-21 | 20 | 18 | 630 | 648 | 9,620,811 | 13,561,811 | 17 | 5,038 | 5,055 | 16,040,264 | 0.19 | 0.11 | 43.35% | 6.74 | 31.51 | -78.63% | 4.68 |
28-May-21 | 21 | 15 | 507 | 522 | 8,896,908 | 12,837,908 | 23 | 5,130 | 5,153 | 18,052,957 | 0.17 | 0.13 | 24.43% | 5.87 | 28.54 | -79.44% | 4.86 |
4-Jun-21 | 22 | 18 | 532 | 550 | 8,401,096 | 12,342,096 | 27 | 5,429 | 5,456 | 19,591,771 | 0.21 | 0.14 | 35.68% | 6.55 | 27.85 | -76.49% | 4.25 |
11-Jun-21 | 23 | 21 | 462 | 483 | 7,801,375 | 11,742,375 | 29 | 5,530 | 5,559 | 21,076,911 | 0.27 | 0.14 | 48.89% | 6.19 | 26.37 | -76.53% | 4.26 |
18-Jun-21 | 24 | 13 | 480 | 493 | 7,013,449 | 10,954,449 | 30 | 5,646 | 5,676 | 22,052,852 | 0.19 | 0.14 | 26.61% | 7.03 | 25.74 | -72.69% | 3.66 |
25-Jun-21 | 25 | 27 | 476 | 503 | 6,165,550 | 10,106,550 | 48 | 5,691 | 5,739 | 22,687,980 | 0.44 | 0.21 | 51.69% | 8.16 | 25.30 | -67.75% | 3.10 |
2-Jul-21 | 26 | 37 | 434 | 471 | 5,569,611 | 9,510,611 | 64 | 6,070 | 6,134 | 23,328,857 | 0.66 | 0.27 | 58.70% | 8.46 | 26.29 | -67.84% | 3.11 |
9-Jul-21 | 27 | 37 | 415 | 452 | 5,213,352 | 9,154,352 | 89 | 6,304 | 6,393 | 23,937,386 | 0.71 | 0.37 | 47.61% | 8.67 | 26.71 | -67.54% | 3.08 |
16-Jul-21 | 28 | 55 | 368 | 423 | 4,997,572 | 8,938,572 | 133 | 6,104 | 6,237 | 24,590,437 | 1.10 | 0.54 | 50.85% | 8.46 | 25.36 | -66.63% | 3.00 |
23-Jul-21 | 29 | 92 | 418 | 510 | 4,838,962 | 8,779,962 | 220 | 7,098 | 7,318 | 25,242,994 | 1.90 | 0.87 | 54.16% | 10.54 | 28.99 | -63.64% | 2.75 |
30-Jul-21 | 30 | 115 | 389 | 504 | 4,717,267 | 8,658,267 | 246 | 6,317 | 6,563 | 25,820,881 | 2.44 | 0.95 | 60.92% | 10.68 | 25.42 | -57.97% | 2.38 |
6-Aug-21 | 31 | 134 | 369 | 503 | 4,612,725 | 8,553,725 | 266 | 6,316 | 6,582 | 26,386,862 | 2.91 | 1.01 | 65.30% | 10.90 | 24.94 | -56.28% | 2.29 |
13-Aug-21 | 32 | 105 | 330 | 435 | 4,486,779 | 8,427,779 | 316 | 6,413 | 6,729 | 27,022,606 | 2.34 | 1.17 | 50.03% | 9.70 | 24.90 | -61.07% | 2.57 |
20-Aug-21 | 33 | 123 | 347 | 470 | 4,301,156 | 8,242,156 | 351 | 6,428 | 6,779 | 27,675,333 | 2.86 | 1.27 | 55.65% | 10.93 | 24.49 | -55.39% | 2.24 |
27-Aug-21 | 34 | 137 | 335 | 472 | 4,075,529 | 8,016,529 | 397 | 6,312 | 6,709 | 28,270,243 | 3.36 | 1.40 | 58.22% | 11.58 | 23.73 | -51.20% | 2.05 |
3-Sep-21 | 35 | 122 | 354 | 476 | 3,936,858 | 7,877,858 | 431 | 6,370 | 6,801 | 28,695,801 | 3.10 | 1.50 | 51.53% | 12.09 | 23.70 | -48.98% | 1.96 |
10-Sep-21 | 36 | 136 | 372 | 508 | 3,843,845 | 7,784,845 | 528 | 7,114 | 7,642 | 29,063,304 | 3.54 | 1.82 | 48.65% | 13.22 | 26.29 | -49.74% | 1.99 |
17-Sep-21 | 37 | 117 | 309 | 426 | 3,771,997 | 7,712,997 | 475 | 6,358 | 6,833 | 29,326,803 | 3.10 | 1.62 | 47.78% | 11.29 | 23.30 | -51.53% | 2.06 |
24-Sep-21 | 38 | 95 | 264 | 359 | 3,696,511 | 7,637,511 | 444 | 5,986 | 6,430 | 29,509,257 | 2.57 | 1.50 | 41.45% | 9.71 | 21.79 | -55.43% | 2.24 |
1 | 2 | 3 | 4 | 5 | 6 | n/a | 7 | 8 | 9 | 10 | 11 | 12 | 13 | 14 | 15 | 16 | 17 |
Here we remove 10-17 year olds from the unvaxxed population in the original ONS data to the number of 4,434,375 as calculated below to arrive at a close approximation to the unvaxxed over 18s.
Unvaccinated Deaths |
Unvaxxed Population |
Unvaxxed Population |
Doubly Vaccinated Deaths |
Covid-Deaths per 100k |
Vaccine Efficacy |
All Deaths |
Vaccine Efficacy |
Death Factor |
|||||||||
Friday | Week | Covid | Non-Covid | All |
18+ |
10+ |
Covid | Non-Covid | All |
Vaxxed |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
Unvaxxed U |
Vaxxed V |
U-V/U U-V/V |
V/U |
8-Jan-21 | 1 | 4,795 | 7,473 | 12,268 | 33,366,061 | 37,800,436 | 1 | 17 | 18 | 268,036 | 14.37 | 0.37 | 97.40 | 36.77 | 6.72 | 81.74 | 0.18 |
15-Jan-21 | 2 | 6,101 | 6,951 | 13,052 | 32,072,538 | 36,506,913 | 14 | 87 | 101 | 400,616 | 19.02 | 3.49 | 81.63 | 40.70 | 25.21 | 38.05 | 0.62 |
22-Jan-21 | 3 | 6,580 | 6,116 | 12,696 | 30,296,905 | 34,731,280 | 25 | 141 | 166 | 407,220 | 21.72 | 6.14 | 71.73 | 41.91 | 40.76 | 2.72 | 0.97 |
29-Jan-21 | 4 | 5,177 | 5,004 | 10,181 | 28,456,079 | 32,890,454 | 25 | 140 | 165 | 411,789 | 18.19 | 6.07 | 66.63 | 35.78 | 40.07 | -10.71 | 1.12 |
5-Feb-21 | 5 | 3,532 | 4,162 | 7,694 | 26,560,983 | 30,995,358 | 18 | 185 | 203 | 421,913 | 13.30 | 4.27 | 67.92 | 28.97 | 48.11 | -39.79 | 1.66 |
12-Feb-21 | 6 | 2,430 | 3,460 | 5,890 | 24,497,162 | 28,931,537 | 17 | 204 | 221 | 435,907 | 9.92 | 3.90 | 60.68 | 24.04 | 50.70 | -52.58 | 2.11 |
19-Feb-21 | 7 | 1,635 | 3,048 | 4,683 | 22,580,739 | 27,015,114 | 25 | 208 | 233 | 453,654 | 7.24 | 5.51 | 23.89 | 20.74 | 51.36 | -59.62 | 2.48 |
26-Feb-21 | 8 | 1,002 | 2,252 | 3,254 | 20,815,370 | 25,249,745 | 6 | 237 | 243 | 511,111 | 4.81 | 1.17 | 75.61 | 15.63 | 47.54 | -67.12 | 3.04 |
5-Mar-21 | 9 | 659 | 1,893 | 2,552 | 19,349,167 | 23,783,542 | 8 | 260 | 268 | 678,100 | 3.41 | 1.18 | 65.36 | 13.19 | 39.52 | -66.63 | 3.00 |
12-Mar-21 | 10 | 391 | 1,668 | 2,059 | 18,049,482 | 22,483,857 | 21 | 344 | 365 | 946,296 | 2.17 | 2.22 | -2.38 | 11.41 | 38.57 | -70.42 | 3.38 |
19-Mar-21 | 11 | 239 | 1,412 | 1,651 | 15,775,017 | 20,209,392 | 9 | 475 | 484 | 1,336,055 | 1.52 | 0.67 | 55.54 | 10.47 | 36.23 | -71.11 | 3.46 |
26-Mar-21 | 12 | 166 | 1,234 | 1,400 | 13,868,550 | 18,302,925 | 17 | 715 | 732 | 2,187,083 | 1.20 | 0.78 | 35.06 | 10.09 | 33.47 | -69.84 | 3.32 |
2-Apr-21 | 13 | 91 | 1,069 | 1,160 | 12,777,013 | 17,211,388 | 21 | 1,182 | 1,203 | 3,797,754 | 0.71 | 0.55 | 22.36 | 9.08 | 31.68 | -71.34 | 3.49 |
9-Apr-21 | 14 | 84 | 962 | 1,046 | 12,513,848 | 16,948,223 | 27 | 1,707 | 1,734 | 5,440,741 | 0.67 | 0.50 | 26.07 | 8.36 | 31.87 | -73.77 | 3.81 |
16-Apr-21 | 15 | 54 | 919 | 973 | 12,098,423 | 16,532,798 | 26 | 2,303 | 2,329 | 7,292,362 | 0.45 | 0.36 | 20.12 | 8.04 | 31.94 | -74.82 | 3.97 |
23-Apr-21 | 16 | 46 | 826 | 872 | 11,480,684 | 15,915,059 | 14 | 2,977 | 2,991 | 9,222,983 | 0.40 | 0.15 | 62.12 | 7.60 | 32.43 | -76.58 | 4.27 |
30-Apr-21 | 17 | 35 | 745 | 780 | 11,062,568 | 15,496,943 | 24 | 3,436 | 3,460 | 10,878,526 | 0.32 | 0.22 | 30.27 | 7.05 | 31.81 | -77.83 | 4.51 |
7-May-21 | 18 | 20 | 641 | 661 | 10,584,099 | 15,018,474 | 28 | 4,218 | 4,246 | 12,540,951 | 0.19 | 0.22 | -15.37 | 6.25 | 33.86 | -81.55 | 5.42 |
14-May-21 | 19 | 20 | 611 | 631 | 9,954,991 | 14,389,366 | 19 | 4,706 | 4,725 | 14,361,121 | 0.20 | 0.13 | 34.15 | 6.34 | 32.90 | -80.73 | 5.19 |
21-May-21 | 20 | 18 | 630 | 648 | 9,127,436 | 13,561,811 | 17 | 5,038 | 5,055 | 16,040,264 | 0.20 | 0.11 | 46.26 | 7.10 | 31.51 | -77.47 | 4.44 |
28-May-21 | 21 | 15 | 507 | 522 | 8,403,533 | 12,837,908 | 23 | 5,130 | 5,153 | 18,052,957 | 0.18 | 0.13 | 28.62 | 6.21 | 28.54 | -78.24 | 4.60 |
4-Jun-21 | 22 | 18 | 532 | 550 | 7,907,721 | 12,342,096 | 27 | 5,429 | 5,456 | 19,591,771 | 0.23 | 0.14 | 39.46 | 6.96 | 27.85 | -75.02 | 4.00 |
11-Jun-21 | 23 | 21 | 462 | 483 | 7,308,000 | 11,742,375 | 29 | 5,530 | 5,559 | 21,076,911 | 0.29 | 0.14 | 52.12 | 6.61 | 26.37 | -74.94 | 3.99 |
18-Jun-21 | 24 | 13 | 480 | 493 | 6,520,074 | 10,954,449 | 30 | 5,646 | 5,676 | 22,052,852 | 0.20 | 0.14 | 31.77 | 7.56 | 25.74 | -70.62 | 3.40 |
25-Jun-21 | 25 | 27 | 476 | 503 | 5,672,175 | 10,106,550 | 48 | 5,691 | 5,739 | 22,687,980 | 0.48 | 0.21 | 55.55 | 8.87 | 25.30 | -64.94 | 2.85 |
2-Jul-21 | 26 | 37 | 434 | 471 | 5,076,236 | 9,510,611 | 64 | 6,070 | 6,134 | 23,328,857 | 0.73 | 0.27 | 62.36 | 9.28 | 26.29 | -64.71 | 2.83 |
9-Jul-21 | 27 | 37 | 415 | 452 | 4,719,977 | 9,154,352 | 89 | 6,304 | 6,393 | 23,937,386 | 0.78 | 0.37 | 52.57 | 9.58 | 26.71 | -64.14 | 2.79 |
16-Jul-21 | 28 | 55 | 368 | 423 | 4,504,197 | 8,938,572 | 133 | 6,104 | 6,237 | 24,590,437 | 1.22 | 0.54 | 55.71 | 9.39 | 25.36 | -62.97 | 2.70 |
23-Jul-21 | 29 | 92 | 418 | 510 | 4,345,587 | 8,779,962 | 220 | 7,098 | 7,318 | 25,242,994 | 2.12 | 0.87 | 58.83 | 11.74 | 28.99 | -59.52 | 2.47 |
30-Jul-21 | 30 | 115 | 389 | 504 | 4,223,892 | 8,658,267 | 246 | 6,317 | 6,563 | 25,820,881 | 2.72 | 0.95 | 65.01 | 11.93 | 25.42 | -53.06 | 2.13 |
6-Aug-21 | 31 | 134 | 369 | 503 | 4,119,350 | 8,553,725 | 266 | 6,316 | 6,582 | 26,386,862 | 3.25 | 1.01 | 69.01 | 12.21 | 24.94 | -51.05 | 2.04 |
13-Aug-21 | 32 | 105 | 330 | 435 | 3,993,404 | 8,427,779 | 316 | 6,413 | 6,729 | 27,022,606 | 2.63 | 1.17 | 55.53 | 10.89 | 24.90 | -56.26 | 2.29 |
20-Aug-21 | 33 | 123 | 347 | 470 | 3,807,781 | 8,242,156 | 351 | 6,428 | 6,779 | 27,675,333 | 3.23 | 1.27 | 60.74 | 12.34 | 24.49 | -49.61 | 1.98 |
27-Aug-21 | 34 | 137 | 335 | 472 | 3,582,154 | 8,016,529 | 397 | 6,312 | 6,709 | 28,270,243 | 3.82 | 1.40 | 63.28 | 13.18 | 23.73 | -44.48 | 1.80 |
3-Sep-21 | 35 | 122 | 354 | 476 | 3,443,483 | 7,877,858 | 431 | 6,370 | 6,801 | 28,695,801 | 3.54 | 1.50 | 57.61 | 13.82 | 23.70 | -41.68 | 1.71 |
10-Sep-21 | 36 | 136 | 372 | 508 | 3,350,470 | 7,784,845 | 528 | 7,114 | 7,642 | 29,063,304 | 4.06 | 1.82 | 55.24 | 15.16 | 26.29 | -42.34 | 1.73 |
17-Sep-21 | 37 | 117 | 309 | 426 | 3,278,622 | 7,712,997 | 475 | 6,358 | 6,833 | 29,326,803 | 3.57 | 1.62 | 54.61 | 12.99 | 23.30 | -44.23 | 1.79 |
24-Sep-21 | 38 | 95 | 264 | 359 | 3,203,136 | 7,637,511 | 444 | 5,986 | 6,430 | 29,509,257 | 2.97 | 1.50 | 49.27 | 11.21 | 21.79 | -48.56 | 1.94 |
The ONS in their Table 4 and Table 5 calculated the death rates per 100k using the complicated age standardised mortality rate formula explained in their report. This is supposed to remove age as a confounding factor in the table above. The main confounding component is the inclusion of death rates for 10-17 year olds in the unvaccinated group during a period when nobody under 18 could become vaccinated. The obvious method of fixing that disparity would be for the ONS to simply remove people whose age was less than 18 from the group. But they chose instead to leave them in and then take them back out again with a complicated formula as bureaucrats love to do.
However we can see how many 10-17 year olds there were in the ONS unvaxxed group on 20-Aug-21 (16-17 year olds were called to be vaccinated on 23-August-21) as follows.
UK 10-17 = 5,305,102 (ONS mid year population estimates June2020)
UK population 10+ = 49,771,233 (ONS mid year population estimates June2020)
On 23-Aug-21
UK singly vaxxed = 39,910,686 (https://coronavirus.data.gov.uk/details/vaccinations)
UK unvaxxed 10+ = 9,860,547
ONS unvaxxed = 8,242,156
Ratio ONS/UK = 83.587%
83.587% of 5,305,102 = 4,434,375
So we should have 4,434,375 10-17s to remove. We took that number from the 10+ unvaxxed population column above to calculate the 18+ column.
Having removed the teenagers we can see where the death rate will be when age has worked its way out of the data (by October22 when everyone over 18 who wanted a second shot has had 10 weeks in which to get one given their call for the 1st shot was June18 and there should be an 8 week gap between shots. So their call for the 2nd shot was August13).
The graph shows that the Death factor projected forward by 5 weeks will still be somewhere close to 2.
All death rates per 100k are calculated by multiplying the number of deaths by 100,000 and dividing them by the population of the group
The Death Factor is simply the ratio of the Vaccinated all cause death rate per 100k to the Unvaccinated
If we go forward by 5 weeks from September24 to October29 we reach the time when everybody 18 and over has had the opportunity to get vaccinated if they want it. So the age disparity between the vaccinated and the unvaccinated will have settled down. The graph above shows that the final position will be that the death rate in the vaccinated people will be TWICE the death rate in unvaccinated people TODAY.
Even that 2:1 ratio is affected by age because younger fitter more athletic and sporty people and people with faith in God or in nature, do not feel the need to take the vaccine because they trust their own bodies and nature or God more than they trust massive profit driven government lobbying Pharmaceutical companies.
However the ONS does not mention this 2:1 final ratio of all cause mortality rates in the vaxxed compared to the unvaxxed in their monolateral pro gene therapy Bulletins. Instead they tell us the following in their latest bureaucratic extravaganza of age standardisation...
This does not plot true death rates by vaccination status against time. It plots Age Standardised Mortality Rate by vaccination status against time.
So the UKHSA says that unvaxxed people are dying of Covid at 5x the rate of the doubly vaxxed due to their age standardisation mortality rate formula. Whereas the raw figures for the week to September24 show that the unvaxxed are only dying at twice the rate of the doubly vaxxed (2.97:1.5) from Covid. Furthermore the doubly vaxxed are dying of all causes at twice the rate of the unvaxxed ! So the thing to do is to look as a the UKHSA Age Standardised Mortality Rates for all causes for the last 10 weeks. Here they are from Table2.
Date | Unvaxxed Age Standardised Death Rate | Doubly Vaxxed Age Standardised Death Rate |
23-Jul-21 | 30 | 18.1 |
30-Jul-21 | 29.8 | 16.2 |
6-Aug-21 | 30.2 | 16 |
13-Aug-21 | 26.2 | 16.4 |
20-Aug-21 | 28.8 | 16.5 |
27-Aug-21 | 29.4 | 16.3 |
3-Sep-21 | 29.5 | 16.5 |
10-Sep-21 | 31.6 | 18.5 |
17-Sep-21 | 26.8 | 16.5 |
24-Sep-21 | 22.9 | 15.5 |
Average | 28.52 | 16.65 |
These are saying the the doubly vaxxed have had on average a true non age biased death rate which is 58% of the unvaxxed death rate from all causes. If that analysis had any bearing on reality at all, then since the doubly vaxxed (who make up the vast majority of the population) would be dying at 58% of the rate of the unvaxxed, all cause mortality for the entire population would be close to 58% of the 5 year average. Because unvaxxed people at present are not dying in significant numbers from Covid and have had no medical intervention. So they would represent the 5 year all cause mortality rate. Well here is the present all cause mortality rate for the entire country... https://www.ons.gov.uk/peoplepopulationandcommunity/birthsdeathsandmarriages/deaths/bulletins/deathsregisteredweeklyinenglandandwalesprovisional/22october2021
All Cause Mortality has not dropped to 58% of the 5 year average. No. It has risen to be around 15% greater than that average. The Age Standardised Mortality Rate produces a work of bureaucratic fiction by a factor of around 2 - so desperate are the government to cover up the true picture for Covid, which is that the vaccinated are presently raising all cause mortality in the UK by 15%. And since they make up 80% of the population, their true age independent death rate will need to be 19% above that of the unvaxxed in order to achieve that.
What this means is that for every person the vaccines are saving from Covid, they are killing 1.19 people from side effects.
Last year at this time all cause mortality was also elevated above the 5 year average due to significant numbers of covid deaths from Wuhan alhpa. This year we have just as many cases, but many fewer deaths, thank God. Because delta, although more infectious, is less lethal. So the elevation is not due to delta. It must be due to the vaccines.
In conclusion: The ASMR formula is biased in favour of the doubly vaxxed and against the unvaxxed by a factor of 2.
What this means is that the true Covid death rate among the vaccinated is no better than among the unvaccinated, which is the inescapable immunological conclusion from the fact that case rates are higher in the vaccinated. For death rates should follow case rates.
The Expose has published this article - https://dailyexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/
A further analysis of this data has been performed by Profs Norman Fenton and Martin Neil - https://rightsfreedoms.wordpress.com/2021/09/27/a-comparison-of-age-adjusted-all-cause-mortality-rates-in-england-between-vaccinated-and-unvaccinated/
Copy email...
Dear Prof Fenton,
It is one of those interesting statistical paradoxes that two groups can have a death rate ratio of 2:1 in one direction and all the subgroups of each group can at the same time have a death ratio of 1:2.
This occurs to groups A and B if for example Group A has one sub group containing 1 death and most of the people And group B has zero deaths in that subgroup and hardly any people in it. In that circumstance Group B has loads of people left to win the battle of the remaining subgroups each of which have more deaths than the corresponding subgroups in Group A
It took me a while to get my head around that concept. Given that it is true.
It is totally misleading to present the global information in subgroup form. It is especially misleading to do that without full subgroup disclosure as you point out.
Here is my manufactured example...
A | A | A | B | B | B | ||
Deaths | Pop | Rate/100k | Deaths | Pop | Rate/100k | Death Factor | |
10 to 59 | 8 | 77,500.00 | 10.32 | 1 | 19,000 | 5.26 | 1.96 |
60-69 | 15 | 7,500.00 | 200.00 | 33 | 27,000 | 122.22 | 1.64 |
70-79 | 15 | 7,500.00 | 200.00 | 33 | 27,000 | 122.22 | 1.64 |
80+ | 15 | 7,500.00 | 200.00 | 34 | 27,000 | 125.93 | 1.59 |
10+ | 50 | 100,000.00 | 50.00 | 100 | 100,000 | 100.00 | 0.50 |
Group A has half the death rates of Group B. But if you stratify it as above you can present that data that each subgroup of A has between a 1.6 and a 1.96 higher death rate than B
They are most definitely playing musical subgroups here. But they are exposed by their all cause age adjusted mortality rates by vaccination status which contradict their non categorised all cause mortality rates by a factor of 2 (58% to 115%) for the last 10 weeks
Has there ever been a medical intervention in the history of epidemiology, which increases susceptibility to a virus, fails to decrease viral load and yet miraculously reduces death rates?
Is there not always a positive correlation between susceptibility and death rates?
It is strange world we live in when a Russian President can correctly lecture us that the same state control concept behind the Bolshevik destruction of the family and the economy in his country is now behind the present malaises of the West
Regards
Gordon
Start date | Appointments available for | Priority group |
---|---|---|
8 December 2020 | Residents in a care home for older adults and their carers; and all aged 80 and over | 1 and part of 2 |
Procedures set out on 9 and 14 January 2021 | Frontline health and social care workers | Part of 2 |
18 January 2021 | All aged 70 and over, and clinically extremely vulnerable individuals | 3 and 4 |
15 February 2021 | All aged 65 and over; and those aged 16 to 64 with underlying health conditions which put them at higher risk of serious disease and mortality | 5 and 6 |
1 March 2021 | All aged 60 and over | 7 |
6 March 2021 | All aged 56 and over | 8 (age adjusted from 55) |
17 March 2021 | All aged 50 and over | 9 |
13 April 2021 | All aged 45 and over | |
26 April 2021 | All aged 44 and over | |
27 April 2021 | All aged 42 and over | |
30 April 2021 | All aged 40 and over | |
13 May 2021 | All aged 38 and over | |
18 May 2021 | All aged 36 and over | |
20 May 2021 | All aged 34 and over | |
22 May 2021 | All aged 32 and over | |
26 May 2021 | All aged 30 and over | |
8 June 2021 | All aged 25 and over | |
15 June 2021 | All aged 23 and over | |
16 June 2021 | All aged 21 and over | |
18 June 2021 | All adults (ie aged 18 and over) - https://en.wikipedia.org/wiki/COVID-19_vaccination_in_the_United_Kingdom | |
23 August 2021 | 16-17 year olds |
Dr Richard Flemming teamed up with Prof Luc Montagnier, who won the Nobel prize for discovering HIV, and filed a case in the Hague along with Holocaust survivors on breaches of the Nuremberg Code by Governments worldwide forcing vaccines on their citizens (see here).
Then he had the obvious idea (which no one else appears to have thought of) to look at some blood under the Microscope and then add some Pfizer Vaccine.
The vaccine destroys all the Haemoglobin in the blood (or deoxygenates it by some other means) and makes the red cells stick together and form clots. It is amazing - the blood just stops being red. That is why people cannot breathe. Watch minute 9 to minute 20 of this video and you will see precisely what the vaccines do to human blood.
https://api.banned.video/embed/617805b37031df173f85c2d9 (https://banned.video/watch?id=617805b37031df173f85c2d9)
When you are jabbed, the vaccine goes into your deltoid muscle hopefully (they are supposed to withdraw the plunger slightly to make sure they have not hit a blood vessel - but they are not generally doing that now). If it hits a blood vessel then what you see in the video happens immediately
If the jab does hit the muscle then the above happens more slowly.
The lighter areas on the left and right pictures are where a drop of the Pfizer vaccine has hit the blood on the 40x microscope slide. You can see that the red colour is missing from the red cells in the vaccine droplet areas. This is the destruction of your haemoglobin by the vaccine (or deoxygenation by some other means). It occurs within seconds according to the video!
If you have no haemoglobin, then your blood cannot carry any oxygen to your tissues and your breathing fails. The video also shows that the haemoglobin/oxygen depleted red blood cells start to stick together. They start to clot within minutes of the vaccine mixing with the blood. The vaccines destroy the blood's ability to carry oxygen to your cells.
Vaccines have not only failed worldwide by every metric. They are have increased infection rates and they have increased mortality rates. The more we vaccinate, the worse they both become. Rather than being safe and effective, hundreds of millions of case numbers and millions of deaths prove them to be dangerous, anti effective and lethal to mankind.
METHOD
We took all the data that there is, from 247 million cases up until 2021 October 31, from the ourworldindata site of Johns Hopkins University, for all 185 nations where they have both the % of people vaccinated and the cumulative confirmed cases per million and the cumulative deaths per million. We split the nations into vaccination decade % groups for 1st vaccination and for 2nd vaccination. The result was the following. - https://ourworldindata.org/covid-cases
Group | Average Cases per million people |
Average Deaths per million people | Nations with 1st Jab % in Group |
0-10% |
3,100.91 | 63.70 | Burundi, Democratic Republic of Congo, South Sudan, Haiti, Chad, Yemen, Madagascar, Tanzania, Cameroon, Mali, Burkina Faso, Zambia, Benin, Niger, Papua New Guinea, Somalia, Sudan, Nigeria, Ethiopia, Sierra Leone, Syria, Malawi, Congo, Gabon, Guinea-Bissau, Afghanistan, Uganda, Liberia, Djibouti, Kenya, Central African Republic, Ghana, Senegal, Cote d'Ivoire, Mozambique, Gambia |
10-20% | 20,365.56 | 447.15 | Togo, Guinea, Namibia, Angola, Iraq, Nicaragua, Algeria, Kyrgyzstan, Armenia, Egypt, Lesotho, Equatorial Guinea, Solomon Islands, Mauritania, Jamaica |
20-30% | 50,098.08 | 1,030.63 | Bulgaria, Eswatini, Moldova, Vanuatu, Libya, Zimbabwe, Bosnia and Herzegovina, Myanmar, Ukraine, Saint Vincent and the Grenadines, Bangladesh, Philippines, Georgia, South Africa, Lebanon, Saint Lucia, Palestine, Tajikistan, Comoros, Rwanda, Botswana, Nepal, Guatemala, Belarus |
30-40% | 49,056.58 | 1,188.37 | Pakistan, Bahamas, Grenada, Romania, Venezuela, Albania, Sao Tome and Principe, Russia, Jordan, Bolivia, Dominica, Honduras, Uzbekistan, North Macedonia |
40-50% | 69,829.58 | 1,427.86 | Timor, Paraguay, Montenegro, Suriname, Indonesia, Kazakhstan, Laos, Trinidad and Tobago, Kiribati, Serbia, Slovakia, Tunisia, Croatia, Kosovo, Guyana, Saint Kitts and Nevis, Belize |
50-60% | 59,886.16 | 1,508.76 | Azerbaijan, Barbados, Cape Verde, India, Poland, Peru, Asia, Antigua and Barbuda, Slovenia, Mexico, Vietnam, Samoa, Czechia, Colombia, Oman, Thailand |
60-70% | 85,628.30 | 1,164.47 | Estonia, Hong Kong, Dominican Republic, Iran, Latvia, Kuwait, Hungary, Greece, Morocco, Turkey, Austria, Liechtenstein, Switzerland, United States, Ecuador, El Salvador, Bahrain, Lithuania, Cyprus, Monaco, Luxembourg, Mongolia, Panama, Saudi Arabia, Germany, Fiji |
70-80% | 78,680.04 | 1,030.27 | Costa Rica, Andorra, Mauritius, Israel, Sri Lanka, Taiwan, Sweden, Maldives, United Kingdom, San Marino, Australia, Brazil, Argentina, Belgium, Bhutan, Netherlands, France, Finland, New Zealand, China, Ireland, Norway, Denmark, Italy, Japan, Malaysia, Canada, Uruguay |
80-90% | 77,597.83 | 821.84 | South Korea, Qatar, Singapore, Cambodia, Spain, Seychelles, Iceland, Malta, Chile, Cuba, Portugal |
Group | Average Cases per million people |
Average Deaths per million people |
Nations with 2nd Jab % in Group |
0-10% |
8,396.86 | 163.36 | Democratic Republic of Congo, Haiti, Chad, South Sudan, Yemen, Guinea-Bissau, Cameroon, Madagascar, Uganda, Ethiopia, Papua New Guinea, Mali, Burkina Faso, Sudan, Sierra Leone, Nigeria, Tanzania, Niger, Benin, Somalia, Congo, Syria, Djibouti, Ghana, Zambia, Malawi, Kenya, Cote d'Ivoire, Gabon, Angola, Senegal, Afghanistan, Togo, Guinea, Nicaragua, Libya, Central African Republic, Liberia, Mozambique, Armenia, Egypt, Iraq, Gambia, Vanuatu, Namibia |
10-20% | 24,974.88 | 602.83 | Myanmar, Algeria, Botswana, Kyrgyzstan, Bangladesh, Jamaica, Sao Tome and Principe, Mauritania, Equatorial Guinea, Rwanda, Bosnia and Herzegovina, Lesotho, Saint Vincent and the Grenadines, Ukraine, Zimbabwe, Uzbekistan, Pakistan, Guatemala, Comoros, Eswatini |
20-30% | 54,251.89 | 995.00 | South Africa, Saint Lucia, Belarus, Kuwait, Venezuela, Moldova, Bulgaria, Tajikistan, Nepal, Lebanon, Georgia, India, Philippines, Vietnam, Palestine, Timor, Indonesia, Grenada, Honduras |
30-40% | 68,460.80 | 1,487.25 | Guyana, Albania, Bahamas, Taiwan, Russia, Bolivia, Romania, Paraguay, Suriname, Jordan, Dominica, Belize, North Macedonia, Cape Verde, Laos, Tunisia, Montenegro, Iran, Kazakhstan |
40-50% | 69,671.12 | 1,573.02 | Kosovo, Colombia, Thailand, Slovakia, Asia, Trinidad and Tobago, Azerbaijan, Barbados, Serbia, Croatia, Saint Kitts and Nevis, Peru, Mexico, Dominican Republic, Costa Rica |
50-60% | 83,205.17 | 1,494.73 | Oman, Antigua and Barbuda, Poland, Latvia, Slovenia, Panama, Brazil, Ecuador, Czechia, Argentina, Turkey, United States, Brunei, Estonia, El Salvador, Morocco, Hong Kong, Monaco, Hungary, Fiji |
60-70% | 91,664.29 | 986.76 | Saudi Arabia, Lithuania, Greece, Andorra, Sri Lanka, Austria, Luxembourg, Switzerland, Cuba, Cyprus, Liechtenstein, Australia, Mongolia, New Zealand, Israel, Bahrain, San Marino, Maldives, Germany, Bhutan, Mauritius, United Kingdom, Sweden, France, Norway, Netherlands, Finland |
70-80% | 71,862.69 | 940.78 | Italy, Japan, Belgium, China, Canada, Malaysia, South Korea, Uruguay, Ireland, Qatar, Denmark, Cambodia, Seychelles, Chile, Singapore, Spain |
80-90% | 73,447.26 | 747.88 | Iceland, Malta, United Arab Emirates, Portugal |
We then presented the data as follows
1. Bar charts for each percentage decade group with the height of the bar representing the average cases per million of all the case rates of the nations in the group
2. Bar charts for each percentage decade group with the height of the bar representing the average Covid-19 deaths per million of all the death rates of the nations in the group
3. Graphs plotting the average cases per million of all the case rates of the nations in the group for each percentage group
4. Graphs plotting the average deaths per million of all the death rates of the nations in the group for each percentage group
Here they are...
EXTRAPOLATION AND AGE ADJUSTMENT
The Taylor series expansion for a function f or a variable x forward by an increment h to second order accuracy is...
f(x+h) = f(x)+hf'(x)+h2f"(x)/2!
The backward difference 1st order approximation for small h for f'(x) = (f(x)-f(x-h))/h
The backward difference 2nd order approximation for small h for f'(x) = (1.5f(x)-2f(x-h)+0.5f(x-2h))/2h2
The backward difference 1st order approximation for small h for f"(x) =
(f(x)-2f(x-h)+f(x-2h))/h2
The backward difference 2nd order approximation for small h for f"(x) =
(2f(x)-5f(x-h)+4f(x-2h)-f(x-3h))/3h2
We use the 1st order approximations because h, the grid spacing (10%) is large. So
f(x+h) = f(x) + f(x)-f(x-h) + (f(x)-2f(x-h)+f(x-2h))/2
f(x+h) = f(90-100%), f(x) = f(80-90%), f(x-h) = f(70-80%) = f(x-2h)= f(60-70%), f(x-3h) = f(50-60%), h=10%
f(90-100%) = 821.84 - 208.43 -37.11 = 576 1Jab
f(90-100%) = 747.88 - 192.9 - 73.46 = 482 2 Jabs.
So the extrapolated 90-100% vaccination figure which would be as age independent as a zero vaccination figure is 576 deaths per million for 1 Jab and 482 for 2 Jabs.
We see no immunological or statistical reason for the true age independent numbers to be anything but linear. Either vaccines work in which case the more you vaccinate the better in a linear manner. Or they do not in which case the more you vaccinate the worse things become in a linear manner.
So we take a linear plot for the age adjusted death rates up to the age free final figures of 576 and 482 as displayed in the graph and bar chart above.
National % Jabbed Group | 1st Jab deaths per million Linearly Age Adjusted |
2nd Jab deaths per million Linearly Age Adjusted |
0-10% | 64.00 | 163.00 |
10-20% | 120.89 | 199.44 |
20-30% | 177.78 | 235.89 |
30-40% | 234.67 | 272.33 |
40-50% | 291.56 | 308.78 |
50-60% | 348.44 | 345.22 |
60-70% | 405.33 | 381.67 |
70-80% | 462.22 | 418.11 |
80-90% | 519.11 | 454.56 |
90-100% | 576.00 | 482.00 |
CONCLUSION
The charts and graphs show...
1. The incidence of cases increases fairly linearly with the percentage of vaccinated people at a rate of 800 cases per million per extra percentage vaccinated. The nations with the lowest case rates are almost exclusively in Africa, which have not done much vaccination. The nations with the highest case rates have done the most vaccination.
2. Heavily vaccinated countries (over 60%) have 3x the case rates of lightly vaccinated countries (under 20%) and have 7x the case rates of very lightly vaccinated countries (under 10%)
3. Raw death rates from Covid-19 increase with vaccination percentage from 0% to 50-60% and then decrease thereafter. Heavily vaccinated countries (over 60%) have twice the Covid-19 death rates of lightly vaccinated countries.
4. The death rates are very high for partially vaccinated countries and come down for highly vaccinated countries because the old are vaccinated first. This skews the early or partially vaccinated death rates against vaccination because the unvaccinated group have a lower average age. But by the time 80-90% are vaccinated, everyone has had the chance to be jabbed and the age skewing will have almost vanished. So the age adjusted death rate will run in a straight line from around 120 deaths per million for unvaxxed nations to around 600 deaths per million for fully vaxxed nations. We put that line in as our attempt at the age adjusted figure. On that basis this data shows that each percentage of vaccination increases the death rate by around 6 deaths per million
5. This data shows that a 2nd Jab offers no significant benefit over a 1st jab except perhaps in the extrapolated/age adjusted death rates.
The inescapable conclusion from all the data we have up to October 31 is that vaccines increase case numbers by 3x-7x and increase death rates from Covid-19 by 2x-4x.. This is not a representative sample of a few thousand cases or deaths from one nation. It is the full study of all the cases so far in every reporting nation. The results are in. There is a massive positive correlation between vaccination % and case numbers and deaths.
Covid vaccination has been the largest experimental intervention in the history of medical science. The work of every government statistics department in 185 nations collated by Johns Hopkins University in Baltimore has produced the largest cohort study ever to be considered. We include the full dataset used below for further analysis by interested parties.
These vaccines are reducing the immunity of the vaccinated and killing them. Vaccinated people are then spreading Covid-19 to the unvaccinated (who would have achieved herd immunity had vaccines never been deployed - as has historically been the case with other viruses), and many of those have died too. This has been an entirely negative intervention.
The death rates above are not all cause mortality. They exclude deaths due to side effects So the true vaccinated death numbers will be even larger.
In heavily vaccinated nations such as the UK, the case rate in the fully vaccinated over 30s is presently only 23-55% higher than the case rate in the unvaccinated. But the case rate in the unvaccinated is elevated due to infection by vaccinated people. The media narrative is that the unvaccinated are infecting the vaccinated. This data indisputably shows that the reverse is the case. This has now become a pandemic of the vaccinated. They are increasing the case numbers in the unvaccinated - because their immune systems are being damaged by the vaccines. That is what the fairly straight and very steep line in the case numbers graph is declaring. Had there been no vaccination in the UK our figures would now be more like those of the African countries at the bottom left of the graph. One of the clearest ways to see that the vaccinated are infecting the unvaccinated is the comparison of 71% vaccinated Israel with 27% vaccinated Palestine. The graph shows Israel leading Palestine in cases and dragging them up above the world average case level.
The death rates suffer from age bias. That is the cause of the hill shaped rather than linear profile of their graph. Immunologically one would expect the true behaviour, with the confounding factor of age removed, to vary linearly with vaccination percentage. It should go down if vaccines work and go up if they do not. Plainly they do not. The all cause mortality rates will be even worse for the vaccinated due to deaths not from Covid, but from vaccine side effects such as coagulopathy, and increased viral susceptibility. The Office of National Statistics in the UK (ONS) produces all cause mortality figures by vaccination status. which in their raw form have higher death rates in the vaccinated than they do in the unvaccinated - see here.
DATA
Here is the table of the data we used taken from - https://ourworldindata.org/covid-cases
Nation | Deaths / million |
Cases / million |
1 Jab % | 2 Jabs % | Nation | Deaths / million | Cases / million |
1 Jab % | 2 Jabs % |
Democratic Republic of Congo | 11.81 | 622.12 | 0.12% | 0.04% | Laos | 8.81 | 5,457.25 | 44.07% | 37.63% |
South Sudan | 11.69 | 1,086.07 | 0.75% | 0.39% | Trinidad and Tobago | 1,208.52 | 40,850.83 | 44.37% | 42.80% |
Haiti | 58.14 | 2,075.95 | 0.76% | 0.31% | Serbia | 1,441.04 | 165,418.64 | 45.60% | 43.44% |
Chad | 10.29 | 299.68 | 0.97% | 0.32% | Slovakia | 2,386.86 | 88,591.33 | 45.73% | 42.16% |
Yemen | 61.95 | 321.12 | 1.05% | 0.47% | Tunisia | 2,114.74 | 59,715.24 | 46.74% | 37.66% |
Madagascar | 33.88 | 1,534.65 | 1.34% | 0.65% | Croatia | 2,258.89 | 115,234.57 | 46.76% | 43.98% |
Tanzania | 11.79 | 425.28 | 1.44% | 1.44% | Kosovo | 1,676.83 | 90,550.86 | 47.39% | 40.83% |
Cameroon | 61.93 | 3,764.99 | 1.53% | 0.59% | Guyana | 1,155.21 | 44,978.74 | 48.11% | 30.52% |
Mali | 27 | 770.68 | 1.55% | 1.26% | Saint Kitts and Nevis | 429.54 | 49,844.99 | 48.41% | 45.35% |
Burkina Faso | 9.96 | 688.14 | 1.62% | 1.29% | Belize | 1,212.60 | 66,181.79 | 49.38% | 35.69% |
Zambia | 193.49 | 11,084.92 | 1.64% | 2.70% | Azerbaijan | 691.95 | 51,976.14 | 51.13% | 42.95% |
Benin | 12.93 | 1,987.71 | 1.92% | 1.67% | Barbados | 531.79 | 61,739.68 | 51.52% | 43.38% |
Niger | 8.48 | 253.31 | 1.99% | 1.58% | Cape Verde | 621.11 | 68,010.20 | 52.20% | 37.57% |
Papua New Guinea | 40.58 | 3,258.58 | 2.02% | 1.17% | India | 329 | 24,605.71 | 52.52% | 23.44% |
Somalia | 73.84 | 1,344.66 | 2.22% | 1.78% | Poland | 2,037.17 | 80,039.34 | 53.53% | 52.78% |
Sudan | 69.01 | 900.33 | 2.57% | 1.30% | Peru | 6,002.68 | 66,002.24 | 56.06% | 45.65% |
Nigeria | 13.7 | 1,002.65 | 2.65% | 1.41% | Asia | 251.35 | 16,964.67 | 56.56% | 42.49% |
Ethiopia | 54.8 | 3,097.89 | 2.97% | 1.06% | Antigua and Barbuda | 1,033.14 | 41,102.83 | 56.66% | 50.20% |
Sierra Leone | 14.86 | 785.74 | 3.91% | 1.36% | Slovenia | 2,282.65 | 161,565.54 | 57.18% | 53.84% |
Syria | 139.97 | 2,360.84 | 3.94% | 2.27% | Mexico | 2,213.73 | 29,227.28 | 57.24% | 46.34% |
Malawi | 117.11 | 3,145.21 | 4.95% | 2.83% | Vietnam | 224.95 | 9,383.04 | 57.67% | 24.36% |
Congo | 45.61 | 3,062.22 | 5.12% | 2.12% | Czechia | 2,867.53 | 164,380.00 | 58.02% | 56.74% |
Gabon | 104.88 | 15,589.15 | 5.53% | 4.27% | Colombia | 2,482.76 | 97,577.39 | 58.32% | 41.24% |
Guinea-Bissau | 69.96 | 3,043.43 | 5.83% | 0.52% | Oman | 787.04 | 58,255.62 | 58.68% | 50.06% |
Afghanistan | 182.75 | 3,922.39 | 6.06% | 5.16% | Thailand | 274.55 | 27,333.82 | 58.72% | 42.13% |
Uganda | 68.22 | 2,677.45 | 6.06% | 0.88% | Estonia | 1,155.31 | 146,370.93 | 60.01% | 57.39% |
Liberia | 55.4 | 1,121.96 | 6.32% | 6.05% | Hong Kong | 28.2 | 1,634.63 | 61.10% | 58.54% |
Djibouti | 180.6 | 13,448.45 | 6.59% | 2.60% | Dominican Republic | 377.04 | 34,843.62 | 61.37% | 48.57% |
Kenya | 96.04 | 4,606.83 | 6.68% | 2.95% | Iran | 1,485.41 | 69,678.05 | 61.39% | 38.91% |
Central African Republic | 20.32 | 2,341.06 | 6.70% | 5.80% | Latvia | 1,742.43 | 117,379.08 | 61.46% | 53.79% |
Ghana | 37.03 | 4,099.22 | 6.77% | 2.62% | Kuwait | 568.55 | 95,338.56 | 61.64% | 21.33% |
Senegal | 109.21 | 4,298.42 | 7.45% | 5.11% | Hungary | 3,189.59 | 89,620.56 | 61.76% | 59.49% |
Cote d'Ivoire | 25.69 | 2,265.76 | 8.37% | 3.25% | Greece | 1,536.82 | 71,563.79 | 64.01% | 61.45% |
Mozambique | 60.01 | 4,703.91 | 8.50% | 6.36% | Morocco | 392.77 | 25,335.40 | 64.41% | 58.47% |
Gambia | 136.71 | 4,006.94 | 9.12% | 8.63% | Turkey | 830.3 | 94,457.90 | 65.12% | 57.16% |
Togo | 28.54 | 3,075.99 | 10.96% | 5.26% | Austria | 1,255.88 | 91,891.45 | 65.26% | 62.16% |
Guinea | 28.52 | 2,271.06 | 11.05% | 5.31% | Liechtenstein | 1,594.60 | 95,728.55 | 65.52% | 63.80% |
Namibia | 1,373.61 | 49,829.86 | 12.41% | 9.79% | Switzerland | 1,288.97 | 100,115.73 | 65.55% | 63.15% |
Angola | 50.39 | 1,898.80 | 13.26% | 4.91% | United States | 2,240.31 | 138,085.62 | 65.78% | 57.16% |
Iraq | 562.66 | 49,909.67 | 13.65% | 8.14% | Ecuador | 1,842.41 | 28,837.51 | 65.97% | 56.41% |
Nicaragua | 31.03 | 2,450.18 | 14.09% | 5.41% | El Salvador | 556.72 | 17,400.01 | 66.19% | 58.13% |
Algeria | 132.69 | 4,627.24 | 14.24% | 10.75% | Bahrain | 796.78 | 158,342.27 | 67.31% | 65.25% |
Kyrgyzstan | 402.97 | 27,346.03 | 14.76% | 11.29% | Lithuania | 2,183.38 | 151,946.46 | 67.34% | 60.93% |
Armenia | 2,131.98 | 103,878.94 | 15.73% | 7.08% | Cyprus | 641.74 | 138,411.06 | 67.43% | 63.51% |
Egypt | 178.89 | 3,174.97 | 16.06% | 8.00% | Monaco | 910.93 | 86,386.64 | 67.49% | 58.98% |
Lesotho | 304.76 | 10,020.53 | 16.11% | 15.72% | Luxembourg | 1,327.95 | 128,672.34 | 67.64% | 62.94% |
Equatorial Guinea | 115.18 | 9,220.00 | 16.65% | 13.07% | Mongolia | 524.14 | 108,226.64 | 67.74% | 64.25% |
Mauritania | 166.91 | 7,815.53 | 19.65% | 12.94% | Panama | 1,669.49 | 107,875.17 | 67.95% | 54.20% |
Jamaica | 751.99 | 29,936.15 | 19.83% | 12.64% | Saudi Arabia | 248.84 | 15,523.67 | 68.44% | 60.71% |
Bulgaria | 3,479.80 | 87,360.03 | 20.41% | 21.87% | Germany | 1,141.05 | 54,921.72 | 68.78% | 66.10% |
Eswatini | 1,059.39 | 39,595.89 | 20.46% | 19.80% | Fiji | 746.48 | 57,748.43 | 69.16% | 59.99% |
Moldova | 1,935.87 | 83,937.85 | 20.50% | 21.66% | Costa Rica | 1,367.76 | 108,910.73 | 70.00% | 49.18% |
Vanuatu | 3.18 | 19.08 | 20.98% | 9.72% | Andorra | 1,680.59 | 200,584.33 | 70.21% | 61.69% |
Libya | 732.77 | 51,352.45 | 21.70% | 5.62% | Mauritius | 130.36 | 13,897.92 | 70.80% | 66.62% |
Zimbabwe | 309.96 | 8,810.99 | 22.00% | 17.27% | Israel | 921.52 | 151,022.96 | 70.89% | 65.15% |
Bosnia and Herzegovina | 3,522.34 | 77,450.95 | 22.50% | 15.57% | Sri Lanka | 639.29 | 25,169.34 | 71.00% | 61.96% |
Myanmar | 341.15 | 9,124.42 | 22.60% | 10.40% | Taiwan | 35.51 | 687.99 | 71.06% | 31.57% |
Ukraine | 1,658.12 | 70,354.99 | 23.37% | 17.07% | Sweden | 1,478.82 | 115,304.49 | 71.35% | 67.85% |
Saint Vincent and the Grenadines | 611.13 | 44,891.21 | 23.55% | 15.96% | Maldives | 447 | 161,211.88 | 72.56% | 65.69% |
Bangladesh | 167.57 | 9,437.80 | 24.22% | 12.38% | United Kingdom | 2,068.04 | 133,423.65 | 73.19% | 66.96% |
Philippines | 388.77 | 25,099.99 | 25.07% | 24.14% | San Marino | 2,705.09 | 163,099.09 | 73.76% | 65.33% |
Georgia | 2,524.01 | 180,725.63 | 25.47% | 22.79% | Australia | 67.59 | 6,670.88 | 74.30% | 63.86% |
South Africa | 1,485.24 | 48,667.87 | 25.51% | 20.49% | Brazil | 2,840.39 | 101,923.01 | 74.40% | 55.27% |
Lebanon | 1,255.99 | 94,845.57 | 26.08% | 22.48% | Argentina | 2,542.44 | 115,967.80 | 74.70% | 56.77% |
Saint Lucia | 1,382.86 | 68,107.01 | 26.80% | 20.62% | Belgium | 2,234.63 | 116,971.37 | 74.77% | 73.53% |
Palestine | 892.82 | 86,735.24 | 27.12% | 24.80% | Bhutan | 3.85 | 3,360.69 | 75.18% | 66.44% |
Tajikistan | 12.82 | 1,793.51 | 27.47% | 21.96% | Netherlands | 1,097.65 | 126,476.34 | 75.63% | 68.63% |
Comoros | 165.46 | 4,793.71 | 27.65% | 18.24% | France | 1,755.74 | 107,579.48 | 75.74% | 67.88% |
Rwanda | 100.25 | 7,509.35 | 27.96% | 14.42% | Finland | 208.71 | 28,392.35 | 76.19% | 69.71% |
Botswana | 1,003.65 | 77,837.01 | 28.21% | 11.16% | New Zealand | 5.76 | 1,356.82 | 76.21% | 64.68% |
Nepal | 384.4 | 27,382.38 | 29.05% | 22.40% | China | 3.21 | 67.39 | 76.22% | 74.12% |
Guatemala | 827.07 | 32,963.09 | 29.13% | 17.80% | Ireland | 1,090.93 | 89,424.56 | 76.46% | 75.21% |
Belarus | 490.42 | 63,557.82 | 29.23% | 21.25% | Norway | 164.66 | 37,924.27 | 76.85% | 68.21% |
Pakistan | 126.36 | 5,655.24 | 31.15% | 17.77% | Denmark | 467.2 | 67,212.58 | 77.04% | 75.87% |
Bahamas | 1,620.00 | 56,311.95 | 33.32% | 30.95% | Italy | 2,188.26 | 79,048.62 | 77.23% | 71.41% |
Grenada | 1,751.98 | 51,674.56 | 33.34% | 26.80% | Japan | 144.98 | 13,673.53 | 77.52% | 71.52% |
Romania | 2,496.42 | 86,159.07 | 33.84% | 32.57% | Malaysia | 882.1 | 75,409.67 | 77.74% | 74.48% |
Venezuela | 170.39 | 14,184.00 | 34.58% | 21.57% | Canada | 762.37 | 45,247.24 | 78.37% | 74.21% |
Albania | 1,017.77 | 64,498.52 | 35.19% | 30.83% | Uruguay | 1,743.97 | 113,022.04 | 79.22% | 75.18% |
Sao Tome and Principe | 250.71 | 16,627.57 | 35.83% | 12.75% | Brunei | 199.31 | 29,737.37 | 79.66% | 57.29% |
Russia | 1,605.04 | 57,418.05 | 37.84% | 32.53% | South Korea | 55.71 | 7,141.31 | 80.10% | 74.63% |
Jordan | 1,074.88 | 83,994.46 | 38.37% | 34.27% | Qatar | 208.15 | 81,639.67 | 80.54% | 75.70% |
Bolivia | 1,599.35 | 43,402.92 | 38.46% | 32.55% | Singapore | 69.02 | 33,641.62 | 80.72% | 79.77% |
Dominica | 443.38 | 66,826.47 | 38.51% | 34.30% | Cambodia | 164.52 | 6,993.91 | 80.88% | 77.04% |
Honduras | 1,017.49 | 37,303.11 | 38.62% | 29.50% | Spain | 1,869.03 | 107,201.31 | 81.37% | 79.83% |
Uzbekistan | 38.98 | 5,479.85 | 39.59% | 17.33% | Seychelles | 1,203.11 | 224,881.20 | 81.99% | 77.12% |
North Macedonia | 3,424.47 | 97,256.35 | 39.92% | 37.19% | Iceland | 96.11 | 39,294.04 | 82.40% | 81.16% |
Timor | 90.78 | 14,726.07 | 40.41% | 26.34% | Malta | 895.9 | 73,174.57 | 83.56% | 83.19% |
Paraguay | 2,250.25 | 63,854.42 | 40.43% | 32.71% | Chile | 1,965.24 | 88,226.95 | 85.78% | 78.54% |
Montenegro | 3,348.45 | 229,780.70 | 40.96% | 38.70% | Cuba | 727.72 | 84,117.62 | 87.07% | 63.37% |
Suriname | 1,845.22 | 82,830.63 | 42.14% | 33.79% | Portugal | 1,785.71 | 107,263.89 | 88.63% | 87.16% |
Indonesia | 518.9 | 15,357.98 | 43.11% | 26.52% | United Arab Emirates | 213.79 | 74,056.54 | 96.62% | 86.62% |
Kazakhstan | 899.08 | 53,712.36 | 43.57% | 39.34% |
C O V I D 1 9
100 +
0 + 5 + 1+500
+ 1
+ 9 = 616, the true number of the Beast in the oldest extant biblical manuscript (P115)
The Latin Numeral System is I = 1, V = 5, X = 10, L = 50, C = 100, D = 500, M = 1000. We take O as 0. Each character in COVID19 is interpreted individually.
The first Century beast was the Roman state, the 7 heads which are 7 mountains of Revelation17, being the 7 hills of Rome. The Harlot riding the beast was the early Roman Catholic Church back then (she is still up to her old tricks). Hence the Roman numerology.
616 is the correct variant rather than 666, according to the Ephraemi Rescriptus Codex, Tyconius a 4th century Christian writer, and P115 - the Oxyrhynchus fragment from 225-275 AD, the oldest extant copy of Revelation13:17. Irenaeus, the 2nd century Christian writer, acknowledged the existence of 616 but rejected it in favour of 666. Irenaeus was in the Catholic Church, which fell as a true church on 84Nisan14 AD. 666 is a triangular number, the sum of all the numbers from 1-36 = 666. It is more spooky and interesting mathematically.
Rome became a multiheaded beast when the Monarchy of the 7 kings from Romulus to Tarquinius Superbus, was overthrown and the Senatus Populus-Que Romanus (SPQR) was established. This is when Rome became a Republic ruled by a representative democracy of Senators, a multi headed Senate, rather than a single headed King. SPQR was founded in 509 BC. 616 years after that, the number of the beast in years from its founding, was 107 AD (there was no 0 BC/AD). So the first century Mark of the Beast came into force then - through the Roman Catholic church?
It therefore behoves us to count 616/666 days of stolen authority over and above the 42 month licence given to the dragon by God and to the sea beast of Revelation13 by the Dragon as follows.
Dragon evicted from heaven Dragon reaches the earth Beast takes authority for 666 days 42 month licence starts
42 month licence ends Demon possession ends
WW3 ends, beast domesticated Beast's 7th head ends
2017Tebbeth20
2017Shebat20
2018Elul6 (666 day from Satan's lease) 2019Iyyar20 (2nd 1NC first fruits)
2022Heshvan14 2023Elul10
2023Heshvan6 (the beast is caught) 2023Tebbeth6
X_______________________X______________________X________________________________X___________________________X___________________X_____________________X______________________________X
30 days down Jacob's ladder
254 days of authority taken
42 months of heavenly authority
412 days of hanging on to power with no divine authority
254 + 412 = 666 The number of days that the beast is given authority not by God but by the Dragon, the number of days that it is down here with stolen non divine authority, the number of days during which it takes authority for itself, the number of its name. 2018Elul6 is the 6th day of the 6th month of the 6th Nisan1 saced year after the end of Satan's 6,000 year lease as Caesar over Adam on 2012Nisan14
17 and in order that not anyone may be able to buy or to sell if not the (one) having the engraving, the name of the wild beast or the number of the name of it.
18 Here the wisdom is; the (one) having mind let him calculate the number of the wild beast, number for of man it is; and the number of it 666 (number of the beast - secular) 616 (number of a man - sacred)
(Revelation 13 KIT)
1 And I saw a wild beast ascending out of the sea, with 10 horns and 7 heads, and upon its horns 10 diadems, but upon its heads blasphemous names. (Revelation 13 NWT)
Dragon's 42 month lease ends
10 Dragon horns start
7 Beast heads start 10 Dragon horns end
10 Beast diadems end
7 Dragon Diadems start
7 Dragon diadems end Dragon goes to Hell
7 Beast heads end
7 Dragon heads start
10 Beast diadems start 7 Dragon heads end End of 2000 days of Mark5 demon possession Beast authority ends
2022Heshvan14
2023Adar6
2023Sivan6
2023Elul10
2023Tebbeth6
X_________________________X_______________________X________________________X__________________________________________X
3 months
4 months
3 months
4 months
3 And was seen other sign in the heaven, and look! dragon great fiery-red, having heads 7 and horns 10 and upon the heads of it 7 diadems, (Revelation 12 KIT)
Horn__________________________10 Horns________________________ Horn
Diadem__________________________________10 Diadems________________________ 10th Diadem ends
10 kings = 10 horns not yet
Leopard________________________4 heads_____________________Leopard/Sea Beast___________________7 heads______________ Sea Beast heads end
received a kingdom
10 kings get authority End of world judicially Transfer begins 4 Leopard heads start
Transfer continues Mark Enforcement
7 Sea heads begin Lava flood ends
Sea Beast caught Kingdom prevails
Zoar ends
1000 day chain ends 1 hour of 42 months 42 month lease ends 10 horns end Chinese drones-Ukraine 10 diadems start
and WW3 begin
4 leopard heads end 4th horse ends WW3 ends
Sea Beast destroyed 12th crop
2022January9-10 2022July29/30
2022November11/12
2022December27/28 2023Jan27-Feb26
2023March3/4
2023April2/3 2023May26/27
2023October21/22 2023October23/24
2023December22/23 Dec 30/31
2021Shebat30 2022Tammuz29
2022Heshvan14
2022Chislev30
2022Shebat
2022Adar6
2023Nisan6
2023Sivan6
2023Heshvan4 2023Heshvan6
2023Tebbeth6
2023Tebbeth14
X__________________X___________________X_____________________X__________________X_____________________X_________________X_________________X____________________X_________________X__________________X___________________X
5 months = 5 horns 3½ months = 3½ horns 1½
months = 1½ horns 66+30 day power + authority transfer to Adar6 from Revelation17:13-14 WW3 runs for 7 heads = 7 months of Daniel3 70 days of leftover ones of Revelation19:21
Total: 300 + 66 + 300 = 666 days of the beast, the number of the beast.
The 1000 day chain of Revelation20 runs from the start of the Dragon's 42 month lease of Revelation13 from 2019Iyyar20, 2nd 1NC first fruits, to 2022Heshvan14. Babylon has to last at least until 2023Chislev14, in order for the late Babylonian LRC Passover to be a proper test on those in fake religion. 2023Sivan6 is the 7th Sabbath of 1NC Weeks, 1 short of the Pentecost. Putin invaded Ukraine on 2021Adar14 (by annexing the Donbas). This cannot have occurred during the 1000 days of the chain. Putin is not the Dragon. The Dragon operates through the intelligence agencies of all the world. Putin is an intelligence agent. The Biden administration green lighted the invasion by demonstrating globalist control of the US military to Putin through the deliberately botched Afghan withdrawal.
2 And he seized the dragon, the original serpent, who is the Devil and Satan, and bound him for 1,000 years [1000 days from 2019Iyyar20 to 2021Shebat30, taking a day for a year following Ezekiel4 and Numbers14 - see U151#20].
3 And he hurled him into the abyss and shut [it] and sealed [it] over him, that he might not mislead the nations [into WW3 by Russia invading Ukraine] anymore until the 1,000 years were ended. After these things he must be let loose for a little while. (Revelation 20 NWT)
Do not try and fool the holy spirit by declaring that you accept the 8 points above when you are not convinced about some of them. Attempting to fool an all seeing God is very dumb, and the result may be disastrous for you (see the account of Ananias and Sapphira in Acts 5). One must embrace the points sincerely/heartily, one must accept them with satisfaction, one must accept them with both the mind and the heart in order to be ready to be baptised. For those who heartily accepted what Peter said were baptised (Acts 2:41). If you have reservations then do the research and have the arguments!
He also reveals that he has seen 1 body marked as a Covid death in all of 2021. So they are hiding the vaccinated Covid deaths. He says before vaccination every body was marked as a Covid death even if they had quite obviously died of something else (they all had false positive PCR tests).
https://theexpose.uk/2021/11/07/british-funeral-director-dead-babies-are-piling-up-in-morgues/
This strongly indicates that Vaccines cause a new form of AIDS because Sepsis is an immune system failure.
Pfizer trial deaths from Dose1 (2019July27) to unblinding after 6 months (2021January) - https://www.nejm.org/doi/10.1056/NEJMoa2110345
Pfizer Phase I-II-III trial deaths from Dose1 to unblinding after 6 months | ||
Group >16 year old | 21,926 double vaxxed | 21,921 unvaxxed |
Deaths | 15 + (2) | 14 + (5) |
Acute respiratory failure | 0 | 1 |
Aortic rupture | 0 | (1) |
Arteriosclerosis | 2 C | 0 |
Biliary cancer metastatic | 0 | 1 |
COVID-19 | 0 | 2 |
COVID-19 pneumonia | 1 | 0 |
Cardiac arrest | 4 C | 1 C |
Cardiac failure congestive | 1 C | 0 |
Cardiorespiratory arrest | 1 C | 1 C |
Chronic obstructive pulmonary disease | (1) | 0 |
Death | 0 | (1) |
Dementia | 0 | (1) |
Emphysematous cholecystitis | 1 I | 0 |
Hemorrhagic stroke | 0 | 1 C |
Hypertensive heart disease | 1 C | 0 |
Lung cancer metastatic | 1 | 0 |
Metastases to liver | 0 | 1 |
Went Missing | 0 | (1) |
Multiple organ dysfunction syndrome | 0 | 2 |
Myocardial infarction | 0 | 2 C |
Overdose | 0 | (1) |
Pneumonia | 0 | 2 |
Sepsis | 1 I | 0 |
Septic shock | 1 I | 0 |
Shigella sepsis | 1 I | 0 |
Unevaluable event | (1) | 0 |
(n) discounted deaths from both groups which were not relevant to the intervention |
Sepsis/Septicemia results from an immune system failure to defeat a microbial (vilral yeast or bacterial) infection.
Emphysematous cholecystitis is a relatively rare variant of acute cholecystitis with infection by gas-producing organisms. Diagnosis involves the demonstration of gas within the lumen or wall of the gallbladder by ultrasound or CT scan. In contrast to acute cholecystitis, emphysematous cholecystitis occurs more commonly in elderly and diabetic patients, and is frequently associated with perforation and death. - https://pubmed.ncbi.nlm.nih.gov/12768870/
It is the result of an immune system failure to defeat a microbial (viral yeast or bacterial) infection.
Acute Cholecystitis. The most frequent cause of acute cholecystitis is gallstones. Other causes include typhoid fever and a malignant tumor obstructing the biliary tract. The inflammation may be secondary to a systemic sepsis. https://medical-dictionary.thefreedictionary.com/emphysematous+cholecystitis
Acute Cholecystitis is a biliary sepsis, a sepsis of the gall bladder and bile ducts.
Pfizer Phase I-II-III Trial Group | 21,926 doubly vaxxed | % | 21,921 unvaxxed | % | 21,923 randomised population | % |
Deaths from all causes during 6 months trial | 17 | 100% | 19 | 100% | 111.2 | 100% |
Death from all vaccine relevant causes. | 15 | 88,2% | 14 | 73.7% | ||
Covid-19 deaths | 1 | 5.9% | 2 | 10.5% | 11.4 | 10.3% |
Cardiovascular deaths (Heart Disease + Stroke) | 9 | 52.9% | 5 | 26.3% | 22.9 + 5.3 = 28.2 | 20.6% + 4.7% = 25.3% |
Sepsis deaths | 4 | 23.5% | 0 | 0% | 1.3 | 1.1% |
Here are the US deaths in 2020 by cause and the percentages for each cause.
US Deaths in 2020 per year | Number | US population 2020 | % |
Total | 3,358,814 | 331,002,647 | 100.0% |
Heart Disease | 690,882 | 331,002,647 | 20.6% |
Cancer | 598,932 | 331,002,647 | 17.8% |
Covid-19 | 345,323 | 331,002,647 | 10.3% |
Accidents | 192,176 | 331,002,647 | 5.7% |
Stroke | 159,050 | 331,002,647 | 4.7% |
Respiratory Disease | 151,637 | 331,002,647 | 4.5% |
Alzheimers | 133,382 | 331,002,647 | 4.0% |
Diabetes | 101,106 | 331,002,647 | 3.0% |
Flu and Pneumonia | 53,495 | 331,002,647 | 1.6% |
Kidney Disease | 52,260 | 331,002,647 | 1.6% |
Suicide | 44,834 | 331,002,647 | 1.3% |
Septicemia (2019) | 38,354 | 331,002,647 | 1.1% |
Other | 797,383 | 331,002,647 | 23.7% |
https://jamanetwork.com/journals/jama/fullarticle/2778234
https://wonder.cdc.gov
The first thing the jumps out of these figures is that Pfizer trial participants had a death rate of 17/19 per 21,921/6 per 6 months. Whereas the general US population has a death rate of 111.2 per 21,923 per 6 months. So Pfizer trial participants were over 6x less likely to die than the general public. The age profile of the original selection of participants is advertised to be
12-15 years old: 2260, 16-17 years old: 754, 18-55 years old: 25,427 years old: 56+ year old: 17,879 - https://www.pfizer.com/science/coronavirus/vaccine/about-our-landmark-trial
So Pfizer must have done some extremely heavy exclusions of morbidities to get such an absurdly low mortality figure. Their study protocol reveals whom they excluded - https://clinicaltrials.gov/ct2/show/NCT04368728
The next thing is the incredible match between the unvaxxed Covid and cardiovascular death rates (10.5% and 26.3%) and those in the general population for 2020 (10.3% and 25.3%). So even though the numbers of deaths are small. They appear to be a very good representation of the reality in general public.
Now we turn to the doubly vaxxed cardiovascular and sepsis rates and we see (52.9% and 23.5% death rates) compared to the general population (and the unvaxxed) who suffer only (26.3% and 1.1% or 25.3% and 0%).
And there is the toxicity of the Pfizer vaccination laid bare. It weakens the immune system to the point where people succumb to microbial infections and die at 21x the normal rate in the first 6 months after vaccination.
One can argue that the numbers of deaths here are not large enough to draw any valid statistical conclusions. But against that the unvaxxed numbers are very clearly representative and the numbers of participants in both groups are large enough to draw valid statistical conclusions from. .
When you combine these figures with the weekly 5% immune response degradation catalogued by the UKHSA from Weeks 35-41 - https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/. You see a picture which says vaccine mediated AIDS.
However you look at this. The numbers flag up two major concerns which these days have plenty of other mass media, clinical and anecdotal evidence to support. These findings absolutely necessitate further investigation specific to Immune system degradation and cardio vascular inflammation. But Pfizer unblinded the placebo group and permitted them to get vaccinated at the end of the 6 month trial period. So it is difficult to see how we can get any more data from Pfizer. To be frank we are lucky to have the death data they have so far provided. Let us face facts. There are no long term clinical trials ongoing into the safety of these vaccines. Quite the reverse in fact. For one can argue that the purpose of the Pfizer lobbied vaccine mandates is to eradicate any unvaccinated control group from existence in order to prevent a proper evaluation of vaccine side effects over the medium term. I wrote a letter to that end to SAGE copied below.
Dear Members of SAGE
I write to inform you of an oversight in your scientific advice on Covid-19.
1. As you will all be aware, the only acceptable scientific method for determining the safety or effectiveness of a medical intervention is to compare its effect upon a randomly chosen experimental group with a control group preferably of similar size for statistical reasons.
Indeed the phase III clinical trials for Pzifer there were 21,712 participants in the vaccinated group and 21,564 in the placebo group, the control group.
The control group, the placebo group is the yardstick with which we measure the effectiveness of the intervention. Only by comparison with a control group can a researcher determine whether an intervention has a statistically significant effect on an experimental group, and the possibility of drawing a false conclusion is mathematically and precisely defined. This A B comparison between intervention and control groups is called the Scientific Method.
So without a control group the Scientific method has been abandoned, we are no longer following any science at all, and no statistically valid conclusion can be drawn from the intervention. Instead science and its method have gone out of the window and we are back in the dark ages of Papal decrees.
2. The medium term (1-3 year) safety or efficacy of the Adenovirus-DNA vaccines and the lipid nanoparticle-mRNA vaccines is not yet known because they have not yet been examined in the general population for more than 10 months.
In this country the intervention group for these vaccines in the age demographic over 18 years old is now over 90% of the population
Why has the Scientific Advisory Group for Emergencies failed to advise the UK government to follow the scientific method and formulate a commensurate control group who do not take the vaccines?
How are we to assess the effectiveness of these vaccine interventions in the absence of such a group?
How can a group of scientists fail so spectacularly to follow not only 'the science' but actually any science at all in what is undoubtedly the most important medical intervention in the UK in the history of science and of medical practice?
May I therefore insist in the name of Science and of the Scientific Method and of Galileo Galilei that you Scientific Advisors take off your papal robes and put your lab coats back on and advise the Government of this Country without further delay to preserve all presently unvaccinated people as members of a vastly undersized, under represented depleted and sadly less than commensurate control group in order that this entire vaccination experiment can actually reach a statistically valid and meaningful conclusion and in order to demonstrate to the government and to the British public and to the world in general - WHAT SCIENCE ACTUALLY IS.
Furthermore if you are going to use children as experimental monkeys for the benefit of adults and against the advice of the JCVI, then would you please ensure that only 50% of them are vaccinated and the remaining 50% are kept free of intervention as a properly sized control group in order that we can learn something from the government's hideous and God awful medical experimentation with them. I ask that in the name of Jesus Christ of Galilee.
Yours Scientifically,
As a final proof that Covid vaccines destroy the immune system, we now have the admission by the CDC in response to a Freedom of Information Request, that they have no record of a person with natural immunity becoming reinfected and transmitting the virus to anybody. Whereas the UKHSA has 450,992 records of people with double vaccine immunity who became infected with Covid in the last 4 weeks. Could there be a clearer demonstration that vaccines prevent people reaching full natural immunity by damaging and degrading their immune systems?
Pfizer is conducting a new study with 2634 participants into the efficacy of its PF-07321332 protease inhibitor drug in multi drug combination with Ritonavir, against recent Covid infection in the unvaccinated.
A Post-Exposure Prophylaxis Study of PF-07321332/Ritonavir in Adult Household Contacts of an Individual With Symptomatic COVID-19 - https://clinicaltrials.gov/ct2/show/NCT05047601
"Ritonavir is 1 of the 4 potent synthetic HIV protease inhibitors, approved by the US Food and Drug Administration (FDA) between 1995 and 1997, that have revolutionised HIV therapy" - - https://pubmed.ncbi.nlm.nih.gov/9812178/
Pfizer excluded HIV positive people and pregnant woman etc. from the study. So here is Pfizer using an HIV drug to tackle Covid.
Pfizer say that: "Co-administration with a low dose of Ritonavir helps slow the metabolism, or breakdown, of PF-07321332 in order for it to remain active in the body for longer periods of time at higher concentrations to help combat the virus" - https://www.pfizer.com/news/press-release/press-release-detail/pfizers-novel-covid-19-oral-antiviral-treatment-candidate
That is true because Ritonavir is known to be a good CYP3A inhibitor and the CYP3A pathway which is used to breakdown drugs like PF-07321332..But Pfizer are omitting to state the primary purpose of Ritonavir, which is that of a well established Protease inhibitor used to treat HIV. Ritonavir has TWO functions. It itself Inhibits proteases (enzymes which break down proteins) just as PF-07321332 does, and it inhibits the CYP3A pathway.
So if we permit ourselves to say what Pfizer refuse to say in their present sales blurb, but which is glaringly obvious from the great success of protease inhibitors as HIV therapies, then we realise that HIV protease inhibitors slow down Covid viral replication themselves. The trial claims 89% efficacy in reducing hospitalisation or death in Covid patients
"Pfizer’s Novel COVID-19 Oral Antiviral Treatment Candidate Reduced Risk of Hospitalization or Death by 89% in Interim Analysis of Phase 2/3 EPIC-HR Study" Their press release of November 5, linked above, declared.
So HIV drugs are very effective against Covid. So Covid and HIV are closely related. So Covid is like HIV in functionality since it is inhibited by an HIV drug and by the precise same class of drugs used to treat HIV (protease inhibitors). The vaccines cause your body to produce the toxic spike protein part of Covid. These spike proteins contain the furin cleavage site from HIV1. So it is absolutely to be expected that both Covid and the vaccines will damage your immune system in a similar manner to HIV, causing a new type of AIDS. In fact Pfizer have just demonstrated that with their clinical trial results. But have been extremely careful not to draw that conclusion themselves.
Billing an HIV drug as a metabolic breakdown inhibitor for PF-07321332, is like billing a Ferrari with an in car stereo as a compact music system.
Indeed the writer would suggest that the precise opposite of what Pfizer is saying could be the case. It may be that the anti HIV drug Ritonavir is 89% effective in treating Covid and that the imaginatively named PF-07321332 is only there to disguise that revelation and to slow down the metabolism by the body of Ritonavir. Pfizer are calling the combination PAXLOVID.
So we are now in the position that Pfizer's actions by including the post heart attack drug Tromethamine (Tris) in the 5-11 year old children's vaccine (https://www.fda.gov/media/153447/download page14) and by demonstrating the 89% clinical efficacy of the anti HIV drug Ritonavir on Covid, reveal that vaccines cause heart attacks in children and that Covid (which infects through the spike protein of the vaccines) has the functionality of HIV and therefore causes a form of AIDS in all age groups.
The UKHSA data for weeks 35 to 41 - https://theexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/
Pfizers 'Landmark' vaccine trial death rates - https://theexpose.uk/2021/11/13/pfizer-trial-data-suggests-covid-19-vaccine-causes-aids/
Global figures from all 185 fully reporting nations - https://theexpose.uk/2021/11/03/worldwide-data-proves-highest-covid-19-death-rates-are-in-most-vaccinated-countries/
This article is published in the Expose - https://dailyexpose.uk/2021/11/20/pfizer-says-using-its-covid-pill-with-hiv-drug-cuts-the-risk-of-death-by-up-to-89-is-this-an-admission-that-the-covid-vaccines-cause-acquired-immunodeficiency-syndrome/
In the UK you’re legally protected from discrimination by the Equality Act 2010.
It is against the law to discriminate against anyone because of:
These are called ‘protected characteristics’. - https://www.gov.uk/discrimination-your-rights
You’re protected from discrimination:
Yet care workers are being sacked because they hold the scientifically justified belief that vaccines are dangerous.
So here is the question. Which is the more important to vaccinated people - their PAYCHEQUE or their MORALITY?
You might think the answer is obvious. My morality can wait, my paycheque cannot. That is short term thinking. And it is fundamentally flawed. The purpose of this article is to explain why it is flawed and how we shall defeat this present tyranny.
It we all choose our paycheques over our morality. then we permit the government to discriminate against the unvaxxed unchallenged.
We signal to them that they can achieve any goal they wish to achieve through financial pressure.
This will empower them to complete their agenda to take over not just our health through mandatory vaccines, but our lives through a social credit score linked digital smart currency.
They will abolish dead dumb money and replace it with a living smart currency which will require a real time social credit score linked government authorisation for every single financial transaction we do.
"Funds available but transaction refused due to insufficient social credit score", you will be told - by your own money !
It will mean that having the money to pay for something will not guarantee that you can buy it. You will need to have the required social credit score for any particular purchase or deal.
And do not be so naive as to believe that social credit scores will be equitably assigned or implemented. If someone with power does not like you, your credit score will magically drop. The whole system is a fundamental abuse of human rights. So it will be just as abusive in its implementation as it is in its conception.
In other words, your money will no longer be your money. It will be the government's money. Yes. You will lose your paycheque entirely. We will all lose our paycheques.
But the robbery will not stop there. You will lose not only your paycheque but actually your entire working capital. You will lose all of your savings. You will lose absolutely everything you have. The government will steal every penny and every asset you have. That is what is at stake here.
Slaves do not have financial independence. And economic slavery will follow the immunological slavery as surely as night follows day. Indeed economic slavery is the goal of the immunological slavery we presently face.
If on the other hand we choose morality over paycheque then the unvaxxed will not lose their jobs because sufficient numbers of their work colleagues will resign in support of their rights to work and people will refuse to work for vaxxist employers.
Then the government will lose its bet that we will abandon our morality in order to keep our paycheque. And we will keep both our freedom and our paycheques.
For it is surely self evident that the defining lesson of the 20th century was do not discriminate, isolate, demonise, segregate, exclude, imprison, kill or otherwise abuse any sector of society on the basis of their race, skin colour, creed, disability, religion, sexual orientation, or political views.
Would you work for an outfit that banned black customers and employees?
Would you work for an outfit that banned Jewish customers and employees?
Would you work for an outfit that banned disabled customers and employees?
Would you work for an outfit that banned homosexual customers and employees?
Would you work for an outfit that banned unvaxxed customers and employees?
If so then you have learned nothing from the 20th century, and you are the modern day Nazi collaborator and Apartheid facilitator. Your moral compass is broken.
The unvaxxed have taken their stand against the new tyranny. But their stand will fail unless they are supported by the vaxxed.
Here is a taste of what is to come to all of us emailed to me from an unvaxxed Austrian on November 18...
"The waitress of the inn informed us yesterday after college that there was a vaccination check police raid at around 10:30. Two police men blocked the backdoor exit while two others entered from the front to check the vaccination certificates. All they were doing was looking for unvaxxed people (fine 500.- EUR).
As one main college program ends tomorrow, many of my colleagues gathered yesterday evening outside the campus at the parking lot to celebrate their marks. There was a police control for vaccination certificates at around 8pm and another at 9:30pm. Everyone was outdoors but still they harassed people as unvaccinated are allowed to go outside for a smoke but not to meet in a group like this. It's horrific.
Between 7000-10000 people gathered yesterday evening in Graz to protest against the government. There was no mentioning of it in the main media. There will however be a demo of up to 100k people in Vienna on Saturday.
I see my country falling apart."
Austria can go a lot further than that as we all know only too well.
So either we stop this now by refusing to work for vaxxist companies, refusing to vote for vaxxist politicians, by suing vaxxist employers for unfair dismissal, by refusing to buy from vaxxist outfits, by refusing to attend events which are hosted by vaxxist performers or vaxxist management companies, by refusing to give our patronage to vaxxist theatres and vaxxist venues. Or we all become Nazi collaborators enjoying a night at the vaxxist opera and dining at the finest vaxxist restaurants whilst our unvaxxed brothers are languishing in isolation centres at best and dying in concentration camps at worst.
The Expose has done a thorough job through dozens of properly researched articles in presenting the overwhelming evidence that the viral load in the doubly vaxxed is presently higher than in the unvaxxed and therefore vaccines make people more likely to spread delta not less. This means that vaccine passports which enable the vaxxed to move freely and limit the movement of the unvaxxed will actually increase Covid cases hospitalisations and deaths rather than decrease them. There is absolutely no valid epidemiological basis for a vaccine passport. That pretext has completely backfired. So today, with what we now know, one cannot hide one's conscious one's subconscious or indeed one's unconscious vaxxism behind a facade of epidemiological legitimacy. The question is no longer medical. It is entirely moral.
So in conclusion. If you choose MORALITY over PAYCHECK you will save them both. But if you choose PAYCHECK over MORALITY you will lose them both. And then you, your family, your friends and all your brothers in humanity will lose absolutely everything.
If you are wondering what a fully immoral world would look like? Wonder no more. It would look like a cemetery. Because contrary to the title of Ms. Minnelli's song: Money does not make the world go around. It stops the world going around for everybody with insufficient funds to rotate. It is morality that keeps this planet spinning. It is human will that is the most powerful force upon it, not greenbacks. It is the human heart that determines what happens in this realm not the pocketbook and that is where the globalists have grossly miscalculated. Because there is no spreadsheet, no smart currency, and no social media databank that can bind the human heart or can imprison the human spirit. So I look forward to the day when Morality triumphs over the Paycheque. And I encourage all readers to make the only sustainable choice sooner rather than later.
This article is published in the Expose - https://dailyexpose.uk/2021/11/20/are-you-a-vaxist-vaxism-is-the-new-racism/
Great Medical and Moral Summary of the Pandemic by Dr. Roger Hodkinson, the former Chairman of the Royal College of Physicians and Surgeons in Canada (based in Ottawa), and for the past 20 years has held the position as Chairman of a Medical Biotechnology company based in North Carolina. He is a medical specialist in pathology, which includes virology, who studied medicine at Cambridge University in the UK
Flu shots do not work because they are designed against last year's pathogen and the flu virus mutates on an annual basis. The golden rule of vaccinology is do not vaccinate people during a pandemic. The vaccine will fail because it will force a mutation. There is no vaccination that works against a coronavirus for any more than a few months.
Further to the letter of Archbishop Carlo Maria Vigano describing the coup d'etat against democracy by assorted billionaires and the threat this poses to the church and to all of our freedoms and his call for an anti globalist alliance, the Lords Witnesses invite the reader to come on a short trip through the bible from Genesis through the Gospels to Revelation, focussing only on scriptures relevant to the present Covid Vaccines. We try to keep this article as doctrine free as we can and just extract the key scriptures which explain the demonic power game we are being subjected to. If you have ever wondered why governments all over the world have replaced democracy with vaxxocracy, here is an answer.
Double Vaccination is the Snake Bite of Genesis 3:15, a Fang for a Jab
15 And I shall put enmity between you [the serpent, Satan's administration] and the woman [Eve - Adam's wife and the Holy Spirit - God's administration] and between your seed [Cain and descendants and converts] and her seed [Abel, then Seth and descendants and converts]. He will ambush you in the head and you will ambush him in the heel. (Genesis 3)
An ambush is a hidden and unexpected attack. God's people (75% of mankind who will be saved into the Kingdom of God) will be ambushed by a snake which bites them in the heel - for that is how snakes attack. The snake depicts Satan's administration because it acts like a snake. It is a metaphor for a slithering, deceptive, sideways moving crooked and lethal outfit. Satan's people will be ambushed in the head which is how you kill a snake. This battle of the seeds is the fight between Good and Evil, which is a recruitment and procreative battle. The first seed of Satan was Cain who was actually the son of Satan and Eve. For Cain means spear/spike in Hebrew. Eve called Cain this because Satan pierced her to create Cain. He pierced her hymen. She had no knowledge of the implications of nakedness prior to that. She was a virgin. Cain was the result of her first intercourse.
Whereas Abel means breath in Hebrew, because Adam loved her and kissed her when creating Abel - something that did not happen during the procreation of Cain. Satan's plan was quite brilliant. He was the firstborn angel of all creation. He was used to being the boss. He was God's CEO in the patriarchal society of the heavens. He was therefore jealous of Adam, who was also firstborn son of God, the firstborn human son rather than the firstborn angelic son. Although Adam was born again aged 30 angelically (before he was presented with Eve) and Satan was given a human body in which to operate as God's representative in Eden. That meant that Satan and Adam were true brothers, both direct angelic-human dual souled sons of God (Jehovah - Yahweh etc.).
All humans are angelic human hybrids actually if the truth be known. For when we dream at night we create an animated movie in real time. That is not something that a human brain with 100 bullion neurons and a cycle time of 80 Hz (for gamma waves) can actually do. It took 24,000 computers running at 3 GigaHertz 24 months to shoot 90 minutes of Monsters University and a further 270 humans working solidly on the project for the same time period. The Pixar render farm did not continuously and exclusively operate render Monsters University for the entire 2 years. But it took 100 million hours of CPU time at 3Ghz with 2 billion transistors per CPU (approx) in 2015, to make 1½ hours of movie.
One CPU core running at 3 GHz with 2 billion transistors = 6 million trillion operations per second
One human brain running at 80Hz with 100 billion neurons = 8 trillion operations per second
So a CPU from 2015 was 750,000x faster than a human brain.
But it would have taken one CPU 100 million hours for 1½ hours of the movie monsters university.
So it would have taken the human brain 75 trillion hours to create a 1½ hour movie.
So the human brain is 50 trillion times too slow to shoot a movie in real time,
let alone interact with said movie. It is 50 million million times too slow. It is 13 orders of magnitude away from that capability.
So we dream in angelic brain which must be 50 trillion times faster than human brains! Actually it is 1 billion times faster and God has rendering software that is at least 50,000 times more efficient than man had in 2015 (ours is quite a bit better in 2021 actually).
This is because Jacob's ladder has 30 steps, a step for a cubit of ark height. And each step is a doubling of brain power during ascension from a human to an angelic brain (at least).
8 Draw near to God, and He will draw near to you. Cleanse [your] hands, sinners! And purify [your] hearts, double minded ones! (James 4 GLT) Literally indecisive. But also twice a clever!
12 Turn to the stronghold, O prisoners of hope! Even today I declare I will return double to you. (Zechariah 9 GLT) Indeed.
10 And when he prayed for his friends, Jehovah turned the captivity of Job; and Jehovah added to Job all which [had been his], to double. (Job 42 GLT)
9 And it happened, when they were crossing, Elijah said to Elisha, Ask what I shall do for you before I am taken from you. And Elisha said, Then let there now be a double mouth/opening of your spirit on me. (2 Kings 2 GLT)
2^10 = 1024 = 1k, 2^20 = 1,048,576, 2^30 = 1,073,741,824. So Angels are 1 billion times more intelligent than humans. Or rather 1 billion times more quick thinking.
Jesus ascended up 50 steps to divinity from 33Nisan16, his human resurrection, his giving his angel to Jehovah for the ransom of Adam, and therefore the start of his ascension to 33Sivan5, God's acceptance of his ransom, and the pouring out of the gifts of the spirit at the end of the 2520 years of the Alienation Times from 2488Sivan5-11 BC. So Gods are 1 million times more intelligent than angels - if the last 20 steps are the same doubling as the first 30. That would make God 1 million billion or one quadrillion times more intelligent than humans. To give some idea of what a billion times more intelligent means. 65 years of life in a human would take 2 seconds of life in an angel.
https://venturebeat.com/2013/04/24/the-making-of-pixars-latest-technological-marvel-monsters-university/
Our spirit, our AI operating system (Artificial Intelligence), our Divine Intelligence (DI) operating system, runs on our angel when we dream. Everyone reading this has run on their own angel every night of their life. Every dream you have ever seen is courtesy of that soul. The human brain is powerful enough to screen the movies created by the angel. But is not powerful enough to create them, to shoot them in real time. So the angelic brain is the movie studio, Dreamworks in fact, and the human brain is the Imax Cinema.
So now, for the first time, Satan has a true brother, a new direct first generation son of God. Adam was not a descendant of Satan. So Satan had no patriarchal authority over Adam. Satan did not like this at all being a spoilt control freak at that time. So his plan was quite brilliant. He would first of all impregnate Eve. Then he would persuade her to eat the fruit which would kill her but God would not be able to kill Cain inside her. So God would have to give her a stay of execution long enough to deliver Cain. Then he would seduce Eve sufficiently deeply to persuade her to kill Adam by enticing him to eat the fruit using her womanly powers which Satan had revealed to her whilst piercing her to produce Cain. The net result would be Cain, his son, would not be under a death penalty. But both Eve and Adam would be. Game over thought Satan. Then Cain could sleep with a descended female angel (who would be a daughter of Satan since all the angels are his children) and Satan would remain the father of all creation. There would be no child of God alive anywhere that was not also a child of his. His monopoly would be preserved. His stranglehold on power would remain intact. His competitor would be eliminated.
11 For this is the message which you have heard from [the] beginning, that we should have love for one another
12 not like Cain, who was out of the wicked one [ek tou ponhrou] and slaughtered his brother. And for the sake of what did he slaughter him? Because his own works were wicked, but those of his brother [were] righteous. (1 John 3)
9 And I will bring forth a seed out of Jacob,[!mi] and out of Judah an inheritor of my mountains: and mine elect shall inherit it, and my servants shall dwell there. (Isaiah 65 KJV)
He carried out his plan successfully, because Adam loved his wife more than he loved God's law not to eat from the tree. And things looked great to Satan, who imagined that God would not remove his firstborn angelic rights and did not imagine that any other angel would be stupid enough to give his life for Adam. He was right on the first count but wrong on the second. A certain 42nd generation angel, who had a rather colourful past, who had lived on the dark side for too long and rejected it was taking an interest in all of this. He was the original prodigal son. He had screwed up everything as an angel. So when he came to his senses and returned to his father, he had asked God to make him just a preadamic human, a caveman, because he no longer felt worthy to be an angel, so reprehensible had been his behaviour.
But God forgave him everything and was overjoyed that he had seen the error of his ways and restored him to full angelic status upon his repentance and showed him more love than he imagined he deserved. Because God understood that he who is forgiven much loves much. So this angel, whose name was Michael, said to himself. I am lucky to be an angel at all. I would have settled for the life of a caveman. I see what happened to Adam here. He had no chance. He had no experience of deception or of sex. He was totally outclassed by Satan. Yet he still loved his wife so much that he killed himself to be with her. I like this guy. I don't like what Satan did to him. I am gonna step in here. I'm gonna save Adam and I am gonna screw Satan. Hey Jehovah: Take my angel for Adam and my human soul. Have them both. Restore him fully on me. This thing that Satan has done will not stand. Not whilst I have the power to stop it.
This was the payback that God knew could result from the forgiveness he had shown to Michael previously. For God knows the power of love better than anyone - having invented it. So of course he accepted Michael's offer and Adam was redeemed. Hence I can write this article and you can read it.
But the MO of Satan had now been established and exposed. He wants to be daddy to everyone. He wants all of mankind to be his seed. That is the battle of the seeds of Genesis 3:15. Satan wishes to appropriate all of God's children to be his children by any means possible. Just as he attempted to do with Adam and Eve in the garden.
It this context we can now revisit the snake bite of Genesis 3:15, an ambush to the heel of the Good seed. The main purpose of the seed of the serpent (who is Cain and his genetic or converted seed) is to make more seed for his side of the battle. So the snake bite to the heel is a means of achieving that. When a snake bites, it injects venom into its victim with two fangs. The heel in bible symbolism is the end of a body temporally and the head is the start of a body temporally. So the heel of the good seed, is the last ones with faith and love who are around at the end of the good seed, the end of this world. So the snake bite is a double injection which affects end times mankind. That is the Covid vaccination. We know this vaccination is from Cain (the seed of the serpent, the seed of Satan) because Cain means spear or spike, and the Covid Vaccinations turn your body into spike factories or Cain factories. This genetically reprograms you to be a son of Cain (Spike) rather than Adam, to be Cainian rather than adamic.
Furthermore thanks to the work of two Swedish geneticists, we know that the mRNA vaccines can enter into the nucleus and prevent your DNA from fixing itself if it is broken. This is necessary to prevent the body from undoing any gene therapy it is being subjected to. The body is designed to prevent its DNA being hacked or changed. To succeed in changing your DNA, a permanent gene therapy has to turn off the DNA fixing mechanism in every cell. Jiang and Mei, proved that the vaccines do this.
Furthermore, the dosage given of mRNA is 14.4 Trillion copies in the Pfizer jab and 48 Trillion copies in the Moderna Jab, in circumstances where a systemic Covid infection only produces between 10-100 billion copies of the virus -
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC7685332/
and people have between 6 Trillion and 35 Trillion cells in their bodies depending upon how you count them and each mRNA copy can program a cell to produce thousands of Spike proteins. So the dosages in the vaccine are not vaccination dosages. They are gene therapy dosages sufficient to infect every cell in your body and designed to provide thousands of spike proteins for each cell of your body! And people are taking 3rd shots of this!
So the spiritual purpose behind the vaccines is to recruit you genetically to be a son of the Serpent, a son of Cain, Cainian rather than a son of Adam, a son of God, Adamic. Of course almost nobody on earth realises this. But there again the serpent ambushes the good seed in the heel. It is an unexpected attack. That is the M.O. of a serpent. Nothing has changed in the 6,013 years since Adam's sin. Becoming a son of Cain does NOT deny you salvation. But it makes salvation more difficult because it gives Satan patriarchal authority over you. This means he can tempt you more effectively. One's genetic makeup (Cainian or Adamic) does not determine one's salvation. It is what one chooses to do in life that determines whether you are good seed or bad seed by salvation covenant.
The Gospels Declare COVID19 to be a Man Made Bioweapon - The Wuhan Lab Leak Theory is Correct27 Then taking Jesus into the praetorium, the soldiers of the governor gathered all the cohort against Him.
28 And stripping Him, they put a scarlet cloak around Him.
29 And plaiting a crown of thorns, they placed [it] on His head, and a reed in His right [hand]. And bowing the knee before Him, they mocked at Him, saying, Hail, King of the Jews.
30 And spitting at Him, [they] took the reed and struck at His head.
31 And when they had mocked Him, they stripped off His cloak, and they put His garments on Him and led Him away to crucify [Him].
(Matthew 27 GLT)
16 And the soldiers led Him away inside the court,
which is [the] praetorium. And they called together all the cohort.
17 And they put purple on Him, and they plaited and placed a crown of thorns on Him.
18 And they began to salute Him, Hail, king of the Jews!
19 And they struck His head with a reed, and spat at Him. And placing the knees, [they] bowed to Him.
20 And when they had mocked Him, they took the purple off Him, and put His own garments on Him. And they led Him out, that they might crucify Him. (Mark 15 GLT)
1 Then Pilate took Jesus and flogged [Him].
2 And having plaited a crown out of thorns, the soldiers put [it] on His head. And they threw a purple mantle around Him,
3 and said, Hail, King of the Jews! And they gave Him blows with the palm.
4 Then Pilate went outside again and said to them,
Behold, I bring Him out to you that you may know that I do not find even one crime in Him!
5 Then Jesus came outside, wearing the thorny crown and the purple mantle. And he said to them, Behold, the Man! (John 19 GLT)
These 3 accounts have end times fulfilments which apply today.
Harvard Medical school first referred to COVID19 as a Crown of thorns in Feb 2020. They did this because a Corona virus of Spike Proteins is indeed a Crown of Thorns. The Latin word Corona, means crown and a spike is a thorn.
The last thing that happened to Jesus before he was led off to be killed was the crown of thorns abuse. Pilate said to the crowds in John 19 : Ecce Homo (Behold the man). So Jesus stands for end times mankind - that is us folks.
The soldiers in Matthew27, Mark15 and John19 are all said to have platted the crown of thorns. A platt is a double helix. A double helix is the structure of DNA. The soldiers are members of a military. In the greater fulfilment they manufacture the crown of thorns, COVID19, by gene splicing, using CRISPR technology - making the double helix DNA for it and then transcribing the RNA from that.
In Matthew27 and Mark15 the soldiers spat upon Jesus. That is how COVID19 is transferred, through tiny droplets of water from the lungs and from the mouth.
In Mark15 and John 19 there is a Thorny Crown in addition to a Crown of Thorns. That is a variant of the crown of thorns.
Here is then is the whole deal: Matthew27 is the story of the manufacture by government backed militaries of COVID19 and the deliberate infection of mankind with this bio weapon
Mark15 is the manufacture by government backed militaries of a variant of COVID19 and its release to infect mankind
In John 19 the soldiers make a crown of thorns but do not spit upon Jesus.
This is the really worrying one. This virus is not transmitted from person to person. It is therefore a result of the vaccine. This must be the delta variant, which evades the vaccine and is the inevitable consequence of vaccinating people during a pandemic which is a recipe for disaster because it forces the virus to mutate so as to evade the vaccine. So delta was created/forced by the vaccines. It was essentially created by Pfizer and Moderna in the sense that the vaccines gave Covid no other option but to mutate into something which evaded them - https://dailyexpose.uk/2021/11/19/dr-roger-hodkinson-you-never-start-a-vax-programme-in-the-middle-of-a-pandemic/
Snakes kill by Injection or suffocation
Snakes kill either by injection of venom (Cobra, Viper, Asp) or by strangulation/suffocation/constriction of the airway and the vascular system (Python, Anaconda, Boa Constrictor).
COVID-19 is the constriction by the serpent (causing death by hypoxia, lack of Oxygen and/or vascular problems and/or cardiac arrest)
Gene therapy vaccines are the snake venom (causing death by slow poisoning of the immune system and by damaging the vascular system etc.).
The vaccines are the Cobras, the Vipers, the Asps, COVID variants are the Pythons, the Anacondas, the Boa Constrictors. Constrictors should not be lethal to man if handled correctly as Margot Robbie revealed in the case of her mum to Chris Pratt whilst he was hosting Jimmy Kimmel live. Likewise COVID-19 if treated properly with the correct therapeutics, should not be lethal to man. But venomous snakes can be lethal to mankind.
COVID19 counts as 616 - the number of the beast in the oldest bible text
C O V I D 1 9
100 +
0 + 5 + 1+500
+ 1
+ 9 = 616, the true number of the Beast
The Latin Numeral System is I = 1, V = 5, X = 10, L = 50, C = 100, D = 500, M = 1000. We take O as 0. Each character in COVID19 is interpreted individually.
COVID 19 stands for COronaVIrus Disease 2019 - Since the first case was identified in 2019.
The first Century beast was the Roman state, the 7 heads which are 7 mountains of Revelation17, being the 7 hills of Rome. The Harlot riding the beast was the early Roman Catholic Church back then (she is still up to her old tricks). Hence the Roman numerology.
616 is the correct variant rather than 666, according to the Ephraemi Rescriptus Codex, Tyconius a 4th century Christian writer, and P115 - the Oxyrhynchus fragment from 225-275 AD, the oldest extant copy of Revelation13:17. Irenaeus, the 2nd century Christian writer, acknowledged its existence but rejected it in favour of 666. Irenaeus was in the Catholic Church, which fell as a true church on 84Nisan14 AD. 666 is a triangular number, the sum of all the numbers from 1-36 = 666. It is more spooky and interesting mathematically.
The Mark of the beast of Revelation13 upon the hand will be vaccine passports and upon the forehead will be social credit scores
11 And I saw another wild beast ascending out of the earth [DEEP
STATE was buried but comes up above ground], and it had 2 horns like a lamb, but it began speaking as a dragon [the globalist UK-US beast - not the ram of Daniel8 which is the UK- US nation state beast. The two 2 horned beasts are competing administrations for the UK- US world power].
12 And it exercises all the authority of the first wild beast in its sight. And it makes the earth and those who dwell in it worship the first wild beast, whose death-stroke got healed [The first wild beast is the UN. The two horned wild beast is not the second wild beast, the US-UK world power preceded the UN notwithstanding it appearing second in this account].
13 And it performs great signs, so that it should even make fire come down out of heaven to the earth in the sight of mankind [false flag terrorism by demonically possessed rogue elements of the security forces,
the stone not cut by hands of Daniel2, the fire signs of 1Kings18 and 2Kings1].
14 And it misleads those who dwell on the earth, because of the signs that were granted it to perform in the sight of the wild beast, while it tells those who dwell on the earth to make an image
TO the wild beast [dative in the Alexandrinus and in the Sinaiticus and the Ephraemi Rescriptus. Every codex has this in the dative. It is not an image OF the beast. It is an image TO the beast. Whose image and inscription is this? asked Jesus. this is the beastmark smart digital currency]
that had the sword-stroke and yet revived [That is the terrible 4th beast of Daniel7 which is the first beast of Revelation13 without the US and now with a competing currency for the dollar].
15 And it was granted to her to give spirit/breath to the image of the wild beast [Once the image of the new global currency replacing the dollar is created it is owned by the new Caesar: The terrible 4th beast of Daniel7 and first beast of Revelation13. Give Caesar's things to Caesar. Hence it is also the image OF the beast. It is given breath in the sense that it is a living smart currency, which speaks, telling you whether you can or cannot buy something dependent upon your social credit score to which it is linked in real time. It is not a dead dumb currency like paper money], so that the image of the wild beast should both speak and cause to be killed all those who would not in any way worship the image of the wild beast [the new smart digital beastcoin global currency].
16 And it puts under compulsion all [ones], the small [ones]
and the great [ones], and the rich [ones] and the poor [ones], and the free [ones] and the enslaved [ones] [counts 6x by comparison],
in order that that they should give these a mark in their right hand or upon their forehead [literally - between the eyes. the mark upon the hand is the vaccine passports governing your actions, the mark between the eyes is the social credit score governing your thoughts],
There is no question that vaccine passports are being compelled all over the world. This is an obvious visible fulfilment of Revelation13. The next step in the compulsion is total exclusion from the financial system unless you are vaccinated. Then you will not be able to buy or sell without the Mark of the Beast - meaning a vaccine passport, a social credit score and the new global digital social credit score linked currency shall we say - the beastmark?
The 7 angels given the 7 golden vials containing the anger of God
1 And I saw another sign in heaven, great and marvellous,
7 angels having the 7 last plagues; for in them is completed the wrath of God.
7 And one of the 4 beasts gave unto the 7 angels 7 golden vials full of the wrath of God, who liveth for ever and ever. (Revelation 15 KJV adapted from the Greek)
1 And I heard a great voice out of the temple saying to the 7 angels, Go your ways, and pour out the vials of the wrath of God upon the earth.
2 And the 1st went, and poured out his vial upon the earth; and there fell a hurtful and malignant ulcer upon the men which had the mark of the beast, and [upon] them which worshipped his image.
3 And the 2nd poured out his vial upon the sea; and it became as the blood of a dead [man]: and every living soul died in the sea.
4 And the 3rd poured out his vial upon the rivers and fountains of waters; and they became blood.
5 And I heard the angel of the waters say, Thou art righteous, O Lord, which art, and wast, and shalt be, because thou hast judged thus.
6 For they have shed the blood of saints and prophets, and thou hast given them blood to drink; for they are worthy.
7 And I heard another out of the altar say, yes, Lord God Almighty, true and righteous [are] thy judgments.
8 And the 4th poured out his vial upon the sun; and power was given unto him to scorch men with fire.
9 And men were scorched with great heat, and blasphemed the name of God, which hath power over these plagues: and they repented not to give him glory.
10 And the 5th poured out his vial upon the seat of the beast; and his kingdom was full of darkness; and they gnawed their tongues for pain
11 And blasphemed the God of heaven because of their pains and their sores, and repented not of their deeds. (Revelation 16 KJV - adapted from the Greek)
Come on! What is the GOLDEN VIAL of today? It is the money making gravy train of indefinite Covid shots from vaccine vials! A guaranteed income for every human enforced by law, underwritten by national governments, indemnified against side effect damage claims.
The 7 golden vials are 7 money making Covid vaccine shots (from vaccine vials) that mankind suffers (before the end of the world)
AND money making Covid vaccine shots for 7 months from the appearance of the ulcers of verse 2 to the end of the world.
The 7 vials (not said to be golden) are not vaccines but are God using vaccines to teach, express anger, condemn, expose etc. God is not in it for the money (the gold).
God does not make the vaccines. But he straight up permits the demons to make them and compel people to take them, as an expression of his anger against the immorality of the faithless and the loveless and to test us and to teach us that we need to hold onto a sustainable morality and stop worshipping high status people and leaders or society is finished.
There will be no 8th vaccine shot because the Kingdom of God will be installed on earth during the 7th vaccine shot.
The Sea is those who do not go to church
The Earth is those who go to church but are not baptised
The Rivers are those who are baptised and go to church
The Fountains are those who baptise in the church
The Angel of the waters is the last Elijah
The Sun is Jesus, the light of the world
Men stand for demon possessed people here. They blaspheme God because they know he is condemning them.
Vial 1 causes hurtful and malignant ulcers (vaccine mediated immune degradation - due to jab)
Vial 2 causes blood to clot (A dead man's blood is all clotted) - due to jab
Vial 3 causes spiritual death (for those who remain in vaccine accepting churches)
Vial 4: empowers Jesus to start the apocalypse, the revealing of what the demons are doing with vaccines and politics and the media etc.
Vial 5 Causes tongue gnawing pain, pains and ulcers (further vaccine mediated immune system degradation and cardiovascular and neurological and inflammatory events due to the jab)
The Apocalypse, the uncovering of the activities of the demons and of the angels, occurs at the 4th Jab. The CDC authorised a 4th jab for 'immunocompromised people' on October20. Turkey is now on the 4th Jab because many countries do not recognised Sinovac, which it used for the first 3 Jabs.
We hope you enjoyed the journey. The demons are only permitted to possess humans for 2,000 days (the 2,000 pigs of Mark5). They have obviously been here for a while because their behaviour is more than evident.
Israeli health ministry advisory committee member and Deputy chief of Israel's biggest hospital Prof Arnon Afek on December 6. - https://twitter.com/DrEliDavid/status/1467787328294993924
How to spot a demon...
1. They have zero empathy
2. They are 100% dishonest
3. They accuse their opponents of doing or intending to do precisely what they themselves are already doing
4. They are obsessed with corrupting children. They cannot stand their innocence.
5. When it is proven that their position is wrong and they are lying, they carry on taking that position anyway. Because they are not interested in right or wrong. They only care about power.
6. They are incredibly Pharisaical. They are 100% immoral but they create a false morality which makes them look 100% moral and makes those who are truly moral look 100% immoral.
7. They do not believe in free speech. They silence and shutdown all opposition
8. Their overall rulership strategy is visibly self defeating, destructive, win lose and bound to fail. But they seem incapable of seeing that.
9. They are not creative or innovative. They are destructive and corrupting and opportunist..
My favourite demonic expression from Hillary Clinton is: The biggest danger to "our democracy" is the desire of the Republicans to retake the Senate!
PHS Cases and Deaths by Vaccination in Scotland from the PHS Covid-19 Statistical Reports published on November 17 and November 24
Week | Unvaxxed Deaths |
1 Jab Deaths |
2/3 Jab Deaths |
Unvaxxed Cases |
Unvaxxed Scots |
Case % | 1 Jab Cases |
1 Jab Scots |
Case % | 2/3 Jab Cases |
2/3 Jab Scots |
Case % |
Oct16-22 | 8 | 4 | 115 | 1,767,851* | 326,423* | 3,836,004* | ||||||
Oct23-29 | 14 | 4 | 110 | 5,713 | 1,651,886 | 0.35% | 1,058 | 345,668 | 0.31% | 11,533 | 3,849,944 | 0.30% |
Oct30-Nov5 | 21 | 3 | 112 | 6,918 | 1,618,090 | 0.43% | 1,216 | 365,990 | 0.33% | 10,794 | 3,862,198 | 0.28% |
Nov6-12 | 11 | 4 | 95 | 8,112 | 1,599,169 | 0.51% | 1,422 | 371,762 | 0.38% | 11,514 | 3,874,621 | 0.30% |
Nov13-19 | 7,968 | 1,587,937 | 0.50% | 1,475 | 373,094 | 0.40% | 11,210 | 3,884,521 | 0.29% | |||
Oct16-Nov12 | 54 | 15 | 442 | 1,659,249 | 352,461 | 3,855,692 | ||||||
Oct23-Nov19 | 28,711 | 1,614,271 | 5,171 | 364,129 | 45,051 | 3,867,821 |
We see 54 deaths and 28,711 cases from 1.6m unvaxxed Scots and 442 deaths and 45,051 cases from 3.8m doubly vaxxed Scots.
* Denotes data taken from the November17 report in which PHS found 80,000 more Scots in total than they found a week later - which is a tragedy.
PHS should remove all those under 12 from the unvaxxed group because they are ineligible for vaccination and they do not die in significant numbers. But instead it leaves them in and then applies the terrible Age Standardised Mortality Rate formula, which we have seen, by comparison with ONS all cause mortality rates, skews the data in favour of vaccination considerably - see https://dailyexpose.uk/2021/11/06/uk-gov-lying-and-hiding-the-fact-covid-19-vaccinated-are-developing-ade/ .
So instead we use the government vaccination stats to remove the under 12s - https://coronavirus.data.gov.uk/details/vaccinations.
We then compare the Scottish figures from the 4 weeks from October16-November12 for deaths and October23-November19 for cases, with the English figures for Weeks 42-45 (October18-November14) for deaths and Weeks 43-46 (October25-November21) for cases.
The English Death figures from Weeks 42-45 are 675 unvaxxed and 2,875 vaxxed - https://assets.publishing.service.gov.uk/government/uploads/system/uploads/attachment_data/file/1034383/Vaccine-surveillance-report-week-46.pdf
Here are the English Case figures for Weeks 43-46, which is October25-November21 from the UKHSA Vaccine Surveillance Report of Week47 . We take the mid point as Nov7
Age group | Total Cases | Vax status unknown |
1
dose 1-20 days before specimen date |
1
dose ≥21 days before specimen date |
2nd
dose ≥14 days before specimen date: double vaxxed |
Unvaccinated cases |
12-18 | 300,318 | 18,197 | 15,924 | 21,610 | 865 | 243,722 |
18-29 | 88,261 | 8,511 | 751 | 8,728 | 42,580 | 27,691 |
30-39 | 126,626 | 9,113 | 610 | 7,206 | 81,808 | 27,889 |
40-49 | 153,385 | 8,270 | 261 | 3,963 | 124,936 | 15,955 |
50-59 | 116,218 | 5,679 | 106 | 1,938 | 101,284 | 7,211 |
60-69 | 65,380 | 3,165 | 48 | 869 | 58,517 | 2,781 |
70-79 | 28,282 | 1,543 | 11 | 226 | 25,435 | 1,067 |
80+ | 9,979 | 669 | 15 | 162 | 8,606 | 527 |
12+ | 888,449 | 55,147 | 17,726 | 44,702 | 444,031 | 326,843 |
We see 326,843 cases from unvaxxed and 444,031 cases from double vaxxed
On November7:12.9% of over 12s in England were unvaxxed and 79.5% were double vaxxed (38,436,862) - https://coronavirus.data.gov.uk/details/vaccinations.
Whereas 9.6% of over 12s in Scotland were unvaxxed and 81.9% we double vaxxed (3,917,210)..
Oct16/23 to Nov12/19 |
1st Jab | 2nd Jab | 0 Jab | 2nd Jab | 0 Jab | 0 Jab Cases |
2 Jab Cases |
0 Jab Case rate per 100k |
2 Jab Case rate per 100k |
Case Rate Ratio |
England | 87.1% | 79.5% | 12.9% | 38,436,862 | 6,236,925 | 326,843 | 444,031 | 5240.5 | 1155.2 | 4.54 |
Scotland | 90.4% | 81.9% | 9.6% | 3,917,210 | 459,160 | 28,711 | 45,051 | 6252.9 | 1150.1 | 5.44 |
Oct16/23 to Nov12/19 |
0 Jab Deaths |
2 Jab Deaths |
0 Jab Death rate per 100k |
2 Jab Death rate per 100k |
Death Rate Ratio |
0 Jab Death rate per 1k cases |
2 Jab Death rate per 1k cases |
Death Rate Ratio |
England | 675 | 2,875 | 10.82 | 7.48 | 1.45 | 2.07 | 6.47 | 3.13 |
Scotland | 54 | 442 | 11.76 | 11.28 | 1.04 | 1.88 | 9.81 | 5.22 |
Scottish deaths are defined as being with Covid listed as a the underlying or contributing cause of death and taken from table20 of the PHS Covid-19 Statistical Report November24.
English deaths are defined as being within 28 days of a positive Covid test and taken from table10 of the UKHSA Vaccine Surveillance Report week 47
Conclusions
1. The doubly vaxxed case rates of 1155.2 for England and 1150.1 for Scotland are almost identical.
2. The unvaxxed case rate is 4.5x the doubly vaxxed case rate in England and 5.4x the doubly vaxxed case rate in Scotland. This may be because more unvaxxed people have natural immunity in England at present
3. The Death Rate Ratio unvaxxed to doubly vaxxed is 1.45 in England and 1.04 in Scotland. This will be due to England using the daft metric of anyone who dies from anything within 28 days of a covid jab, whilst Scotland uses the more medically sound definition of anyone who dies with covid-19 on the death certificate as either the underlying cause or a contributing cause of death.
So PHE (now the UKHSA) have been effectively exaggerating the life saving performance of the vaccines by using a daft definition of Covid death. The more accurate position, taken by Scotland, is that being unvaccinated gives one presently a 4% greater chance of dying from Covid than being vaccinated in raw data terms rather than a 45% greater chance (having removed the under 12s from both groups).
However there will still be some degree of age confounding in these raw data because the doubly vaccinated group will be older on average than the unvaccinated group because only 32% of 12-15 year olds were double jabbed and only 57% of 16-17 year olds were double jabbed on November7. So that removes a further 2.35m from serious contention for death in the unvaxxed out of 6,236,935 in England, which is 38% of them. So we can make the data pretty age independent by regarding the unvaxxed group as being perhaps 45% smaller than it actually is (to account for the lower vaccination percentages in all the younger age groups - bearing in mind that delta is not the same as alpha and beta. It is less lethal to older people and more lethal to younger people).. The true age independent figure for the whole unvaccinated group would then be 1/0.55 = 1.82 or 82% higher than 1.04. So it would be 1.04/0.55 = 1.89. So the unvaxxed presently have a 89% increased chance of death. But that is only Covid death. It is not all cause mortality. The figure ignores deaths due to vaccine side effects, which Pfizer, Moderna the CDC, the FDA, the UKHSA and PHS all studiously ignore. These can easily overcome that 89% in the short term and can swamp it in the medium term, with vaccine mediated cardiovascular, immune system and nervous system degradation. Indeed UK ICUs have recently reported an increase in immune compromised patients - https://www.dailymail.co.uk/health/article-10224691/Has-jab-farce-landed-hundreds-intensive-care.html
4. The Death rates per 1,000 cases are the truly astounding result from this analysis. The English figure is fairly meaningless due to the daft definition of a Covid death. But the Scottish figure is far more reality based and shows that doubly vaccinated people are 520% more likely to die if they get Covid-19 than unvaxxed people. Admittedly that figure is again confounded by age in the same way that the death rate per million people is. But again that confounding will be largely fixed by regarding the unvaxxed group as being 45% smaller than it actually is, which reduces the Death rate per case ratio from 520% to 286%.
So all things considered doubly vaccinated people are 286% more likely to die of Covid after infection than unvaccinated people. That does drive a coach and horses through the concept that vaccines do not prevent infection but do stop people dying from Covid. With the proper definition of a Covid death, the Scottish figures show the reverse.
What is happening here is that the vaccines do prevent infection and death immediately after vaccination. more by putting the immune system on red alert when it is overwhelmed by genetically programmed spike protein production, than by teaching it to recognise and attack the Wuhan Hu1 spike protein, which it is never going to see these days. And then after 4 to 6 months the vaccines lose their efficacy entirely and go negative (see also the Swedish study) and you end up in a worse position than when you started as regards your chances of being infected (if you are over 30) and as regards dying from all causes. But you end up better off as regards dying from Covid unless you are over 30 and here is why...
It is true to say on average that, throughout the 4 week period, the vaccinated are less likely to be infected and less likely to die of Covid. But this statistical whitewash is only achieved because Pfizer is cannily (and despicably) arranging for a continual supply of vaccine virgins in the form of younger and younger children, who benefit from the initial vaccine efficacy, for a long enough time to keep the overall figures just above water. The children make it easier for government stats departments to hide the longer term detrimental effects of the vaccines. The young are not being sacrificed to protect the old. They are being sacrificed to cover up the danger to the old and to them.
We have seen from the last 11 weeks of UKHSA data that doubly vaxxed over 30s are more likely to be infected than unvaxxed over 30s (unless boosted). But this new data from Scotland is telling us that doubly vaxxed people when infected are more likely to die than unvaxxed people. Therefore it must be the case that doubly vaxxed over 30s, if not boosted, are more than 286% more likely to die and more than 20% more likely to be infected than unvaxxed over 30s. And if 2 shots put you in a worse position than none after 4-6 months, then it will not be long before 3 shots puts you in a worse position than 2.
So no longer are the vaccines effective and no longer are they safe.
Make no mistake. When the US government bans discussion of election fraud it is because they have committed election fraud and need to hide it. In fact whenever a political election is very close, the chances are that the side who just wins has cheated just enough to win. Because true polls do not give 49.9% to 50.1% results very often at all. Likewise, when Pfizer stops its 3 year trial after 6 months, and when Moderna stops its 2¼ year trial 28 days after the 2nd jab it is because they are committing medical fraud and need to hide it. They, more than anybody, know how dangerous these vaccines are. That is why they stopped the trials. Nobody spends fortunes on big expensive clinical trials without doing a small mini trial for their own benefit first to see what the truth is.
I must restate two fundamental principles of immunology here which the main stream media have cancelled completely.
1. You never start a vaccination program during a pandemic. Because you massively increase the chances of teaching the virus to evade the vaccine. That may be the origin of the delta variant.
2. Vaccines cannot lose efficiency. They are a digital switch, a quick training course for the immune system. The are supposed to operate for a couple of weeks,
the length of a typical viral infection, and then they are supposed to clear off. They have no work to do after that. It is not possible for them to lose efficacy over time because they are a one shot device. Either they train the immune system or they do not. That training is finished in the first 2 weeks after injection.
Vaccines are not losing effectiveness. The immune systems of the vaccinated are losing effectiveness. That is vaccine mediated AIDS. Immune systems continue to work after the 2 week vaccine training period. Vaccines do not.
Here is how you kill billions of people with biological warfare.
1. Release a souped up flu which requires a vaccination.
2. Design the vaccine to be a Trojan, which protects against the souped up flu but also progressively destroys the immune system's capability to fight future viruses.
3. Vaccinate as many people as you possibly can
4. Once the Trojan has had enough time to destroy most of the viral defences of most vaccinated people, and just when people are beginning to realise what is going on, release your piece de resistance. A gain of function super deadly flu with a massively increased death rate.
On Wednesday November24 the UK Daily Mail, reported that the Botswana Variant has been discovered. It is called the Omega variant. It is more transmissible but less lethal than delta apparently..
A new study of 566 patients who received either the Pfizer or Moderna vaccines shows that signs of cardiovascular damage soared following the 2nd shot. The risk of heart attacks or other severe coronary problems more than doubled months after the vaccines were administered, based on changes in markers of inflammation and other cell damage.
Patients had a 1 in 4 risk for severe problems after the vaccines, compared to 1 in 9 before.
Dr. Steven Gundry, a Nebraska physician and retired cardiac surgeon, presented the findings at the Scientific Sessions of the American Heart Association’s annual conference in Boston On November12-14. An abstract of his paper was published on November8 in Circulation, the AHA’s scientific journal.
https://www.opindia.com/2021/11/mrna-covid-19-vaccines-increase-possibility-of-coronary-diseases-study/amp/
https://www.ahajournals.org/doi/abs/10.1161/circ.144.suppl_1.10712?s=09
This is not the only study to have found this result. According to British cardiologist Dr. Aseem Malhotra, a whistleblower cardiology researcher from the cardiology department of a prestigious British Institution contacted him to inform that research done by the department has found similar results. The whistle-blower told Malhotra that they have found links between the inflammation of coronary a